KEGG   Acanthaster planci (crown-of-thorns starfish): 110983783Help
Entry
110983783         CDS       T05078                                 

Definition
(RefSeq) myotubularin-related protein 8-like isoform X1
  KO
K18083  myotubularin-related protein 6/7/8 [EC:3.1.3.64 3.1.3.95]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
aplc00562  Inositol phosphate metabolism
aplc01100  Metabolic pathways
aplc04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110983783
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    110983783
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aplc01009]
    110983783
Enzymes [BR:aplc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     110983783
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     110983783
Protein phosphatases and associated proteins [BR:aplc01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    110983783
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related FYVE GRAM DSPc Y_phosphatase3 Y_phosphatase
Motif
Other DBs
NCBI-GeneID: 110983783
NCBI-ProteinID: XP_022099030
Position
Unknown
AA seq 752 aa AA seqDB search
MKIFIFLPQMEHITTPKIEDVRLLDRFNTRKPALGNLYLTATHLIFVDPAGKRETWIQHM
HISSVEKLPLTTSGSPLQIRCKTFQTATFVIPREKSCQELYTSLQKLSKPATLNEVYAFH
YKSASFQTGLPARWDPFDLKADYARMGVPNGNWCATSVNKNYEICDTYPKVIHVPVSAST
PVLVGSARFRSRGRLPVLSYLHKDNNASMSRCSQPLAGFSARCLEDEQMLQAILKTNPKS
TFMYVVDTRPKINAMVNKASGKGYESTDFYTNIKFKFLGIENIHVMRNSLQKLTEVCELK
NPSMEAFLTGLENSGWLKHIKAIMDTSAFIARALSDEGVSVLVHCSDGWDRTAQTCSLAS
LLLDSYYRTIQGFQVLIEKEWLAFGHKFLDRCGLVSYDSREFSPVFTQFVDCVWQLTQQF
PCAFQFNERFLLELHDHVFSCQFGNFLGNCEKDRVDNRISERTYSLWAYMQERMADYYNP
LYKADSPATGGILRPNLTPQMFRFWRGMYNRYDNGVHPREPIADILNAMKDHSSSLSDHV
QFLENKVSCLKDILGVSEDGDVSDLSDGKAASLPEISSLESSSEDSSEKELDTSIPPDNK
TLENHRSAMTDNRRADQGLLLNSPNKPINIRREDSGEILSASLLAEAVESVSLNWRGFRN
IRQCVCSSPFDHFSRKYHCWKCGEVFCIRCIDKQTTLPGHFYERPVAVCRPCYKELKLGS
SDAASPPPSQPTSPSITTFQPQLDNLINENHN
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattttcatttttttaccccaaatggagcacatcacaacaccgaagattgaagat
gttcgattgctggatcgatttaacactcggaaaccggcattgggtaacctctacctgaca
gccacacatctcatatttgtggatccagctggcaagagggaaacttggatccagcacatg
cacatctcctcggtggagaagctgcccttgacgacatcgggctcaccgctgcagatccgc
tgtaagacattccagacggcgacgtttgtgattcccagagagaagagctgccaggagctg
tacacgtccctgcagaagctttccaaaccagcaacattaaatgaggtctacgcatttcac
tacaagtcagccagcttccagactggcctgcctgcccgctgggacccatttgatctgaag
gccgactacgctcgcatgggggtccccaatggcaactggtgtgccacatcagtcaacaag
aactacgagatttgtgacacctatcccaaggtgatccacgtgcccgtctcagccagtact
ccagtgttggtaggcagtgcccgattccgcagccggggcagactaccagtattgtcctac
ctccacaaagataacaatgcaagcatgtctcgctgcagccagcctttggctggcttcagt
gcacgctgtcttgaggacgagcagatgttacaggctatcctgaagaccaatcccaaaagc
actttcatgtacgttgtggacacaaggccaaagattaatgccatggtcaacaaagcctca
gggaaggggtacgaaagcacggatttctacaccaacatcaagttcaagttcctgggcatc
gagaacatccacgtaatgaggaacagcctgcaaaagcttacagaagtgtgtgagttgaag
aatccttccatggaagcctttctgactggtctagagaacagcggctggctcaaacacatc
aaggctataatggatacctcagccttcattgcaagggctctctctgatgagggtgttagt
gtgttagtccactgctctgatggctgggaccggaccgcacagacatgctctctggctagt
ctactacttgattcatactacagaacgatacagggctttcaggttttaatagagaaggaa
tggctagcatttgggcacaagtttcttgacaggtgcggcctggtgtcatatgactcccgc
gagttctcaccggtcttcacgcagtttgtggactgcgtctggcagctgacccagcagttc
ccctgtgctttccagtttaatgaacggttcctcctggagctccatgaccatgtcttctcc
tgccagtttggtaacttccttggcaactgtgagaaggaccgcgtggacaacaggatatcg
gagaggacctactctctctgggcctacatgcaggagcgcatggccgactactacaaccca
ctctacaaggcagactcaccagccacggggggcatcctcaggcccaacctgaccccacag
atgttcagattctggagggggatgtacaatcgctatgacaacggcgtacacccgcgtgag
ccaatagctgatatcctcaatgccatgaaggaccacagctcttcactctctgaccacgtc
caattcttagaaaataaagtttcatgtttaaaggatattctgggtgttagcgaggatggc
gatgtgtcggatttgtctgatggcaaagctgcctcgttacctgaaatcagctccttggag
agcagctcagaggatagctcggagaaagagctggacacctccatcccgccagacaacaag
actctggagaaccaccgcagtgcaatgacagacaaccggcgagcagaccaggggttgttg
ctgaattctcccaacaagcccatcaacatccggagggaggatagtggggagattttgtcg
gcatctctgctggccgaggccgtggagtctgtgagcctgaactggcgtggattcaggaat
attcgtcagtgtgtgtgttcatccccatttgatcacttcagtcggaagtaccattgctgg
aagtgcggtgaggtcttctgcatcaggtgcatcgacaagcagaccacgctcccaggccac
ttctatgagcgtcccgtagcggtctgccggccctgctacaaggagctgaagctggggtca
tcggacgccgcctcaccccccccatcccagcccacgtccccatccatcaccacgttccag
ccacagctggacaacctcatcaacgagaatcacaattga

DBGET integrated database retrieval system