KEGG   Acanthaster planci (crown-of-thorns starfish): 110984778Help
Entry
110984778         CDS       T05078                                 

Definition
(RefSeq) G-protein coupled receptor moody-like
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
aplc04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110984778
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:aplc04030]
    110984778
G protein-coupled receptors [BR:aplc04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    110984778
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx 7TM_GPCR_Srv Git3 zf-LITAF-like
Motif
Other DBs
NCBI-GeneID: 110984778
NCBI-ProteinID: XP_022100956
Position
Unknown
AA seq 368 aa AA seqDB search
MEKEYSIMNSTVADPTDSSQSLYSYEARFGLAFVWSAAAVLGLVGNSLVIWSVVLSKKLR
TVTNAFVVNLSVADFWTSLSYPWEVVAMLQDDSWPMASEVPCVIAAIQVYTGLGASLLSL
AVIAFNRFMLVTQTTATYRHWYSPGKVSVMIATTWICPFFVFLLPPVIGIGEIGYDPQDH
TCSDKDGHPRGTEYNLAQSLGLFPVPMVIIVSSYLALYIHLKRHFRKQKKRRTQYANPAQ
DDTSAVSHSTVSFSVANECPATQQNQTTRNQRRAISRQQLAITKNLFMVFCIFISLMAPY
FVSLAVPSGRRFALYGLTISIVNSCVNPILYTVNHPHFKGVLRSILRCRYSQIPEPSDWL
KSVLSRHQ
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagagtattcaatcatgaactccaccgtcgccgacccgactgactccagccag
tctctctactcgtacgaggcccgattcggtctcgccttcgtgtggtccgcagccgctgtg
cttggtctggtggggaacagcctcgtgatctggtcggtcgttctctccaagaagctccgc
accgtgaccaacgccttcgtggtcaacctcagcgtggccgatttctggaccagtctgtcc
tatccttgggaggtggtggccatgttgcaggatgattcttggccgatggcctcggaggtc
ccctgcgtcatcgctgccatacaagtttacaccggtctcggcgccagcttgctgtctctg
gcagtgatagcgttcaatcgcttcatgctggtcacccagaccaccgcaacgtacaggcat
tggtactccccgggaaaagtctccgtcatgatcgccacgacttggatctgcccgtttttc
gtgttcctcctccccccagtcataggcatcggagagataggatacgatccccaagaccac
acttgctctgacaaggacggacacccgcgcgggacagaatacaacctggctcaatctctg
ggtctgttccctgtcccaatggttataatcgtcagttcctacttggcattgtacatccat
ctcaaacgtcacttcagaaagcagaagaagaggcgcacccagtacgccaacccagctcag
gatgacacgtcagcagtttcgcattcgaccgtcagttttagcgtcgcgaacgagtgcccc
gcaacacagcaaaaccagacgaccagaaaccaacgacgagcaatcagccgtcagcagctg
gcgatcaccaagaacctcttcatggttttctgcatctttatatccctgatggccccttac
tttgtctccctggcagtaccttccggtcgcaggttcgctctgtacggactgaccatcagc
atcgttaacagctgcgtgaaccccattctctacacggtcaaccatccccacttcaaggga
gttcttcggagcatccttcgctgccgctactcgcagatacccgaaccatccgactggttg
aaatctgtcctgtcccgtcatcagtga

DBGET integrated database retrieval system