KEGG   Acanthaster planci (crown-of-thorns starfish): 110985670Help
Entry
110985670         CDS       T05078                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform-like isoform X1
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
aplc00071  Fatty acid degradation
aplc01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110985670
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:aplc03029]
    110985670
Enzymes [BR:aplc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     110985670
Mitochondrial biogenesis [BR:aplc03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    110985670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N VEGFR-2_TMD
Motif
Other DBs
NCBI-GeneID: 110985670
NCBI-ProteinID: XP_022102550
Position
Unknown
AA seq 800 aa AA seqDB search
MAEAHAAVAFQFTVTNEGIDFDINHEALKAVFESGMRSWVKRFRRFQNGMVNTTYPASPL
SWLAVLTAVTACSLARVDPSMGMIEKLKENVLPVDYLGPAPTIYLSTVIFATFLWLAIIF
TLRFILKRLLSYRGFMYEVRGKVSIQTKIWAMLLKCFVTRKPRLFSYQNALPNLPLPSLH
DTMRRYLLSVRGFLNDEEFEQMELLVKDFEVGLGPRLQRYLRLKWLWSVNYVSDWWEEYV
YLRGRDPIMVNSNYYGMDSIAMQPTNIQAARAANFTISLLRFRREIERETLKPLMMQGMV
PLCSYQYERLFNTTRMPGLETDTLVHHKDSKHIVVLSRGRFYKLVFQVNGTMLSPAELQK
QFQWIIDDPSEPMEGEEHLPALTAGDRIPWALARQRFFTRGVNKISLRAIDTAAFMVILD
EEEQDYDTEPLKGILANQTLPPWYKGLPQESTDSQFPTPLKDDWNQNRKLDKFSHSLLAG
NGYNRWFDKCFNLVIFKNGRMGVNAEHSLADSPVMAHLFEYAFGEDIMVIGYNADGSCKG
EVKATYAPPVHLKWELPDEVRTVMETSLETAKKIADDLDFHLLVHNQFGKGAMKKCKVSP
DAFIQMGMQLAYFRDAGKFNLTYEASMTRLFRDGRTETVRPCTISSCDFVKCMEDPSSSK
AQRLAAFRKACDAHVAGYRDAMCGKGIDRHLFCLYVVSKYLNEESPFLQKVLSEPWRLST
SQTPHQQMNKLDITKHPEYISAGGGFGPVARDGYGVSYIIAGEDVVFYHVSSNNSSASTD
SWRFAKGIIKANRDILSLFQ
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagcccacgctgctgtggctttccagttcacggtcaccaatgaagggatcgac
ttcgacatcaaccatgaggctttgaaggctgtctttgaaagtggcatgcggtcatgggtc
aagagattcagacgtttccagaatggtatggtcaacaccacctatcctgccagtccgttg
agctggctagccgtcctgacagcggtgacggcttgttcattggcgcgtgtggatccttcc
atggggatgattgagaagctcaaggagaatgtcttaccagtggactatcttgggccagcg
cctaccatctatctctccacggtcatctttgccacgttcctgtggctggctatcatcttc
acgttgcggttcatcctgaagcgtctgctctcctataggggtttcatgtatgaggtgcga
ggcaaagtgtctatacagaccaagatctgggctatgcttttgaagtgttttgtaacgagg
aagcctcgtctgttcagctatcagaacgcactgcctaacttgcctctgccatcattgcat
gacacaatgagaaggtatctgctctctgtgcgtgggtttctcaacgacgaagagtttgaa
cagatggagcttcttgtcaaggactttgaggtggggcttggtccgcgcctgcagcgctac
ctccggctgaagtggttgtggtctgtcaattacgtcagcgactggtgggaggagtatgtt
tatctgagggggcgggatccaatcatggttaacagcaactactacggaatggattccata
gccatgcagccgaccaacatacaggcggcacgggcggccaatttcaccatcagcctgctg
cgcttccgccgcgagatcgaacgggagaccctgaagccactgatgatgcaaggcatggtt
ccgctatgttcctaccagtacgaacgtctcttcaacaccacacgcatgccgggtctggaa
acagacaccctggtccaccataaggacagcaagcacattgtggtcctcagccggggccgc
ttctacaaactggtcttccaggtgaacggcaccatgctaagtccagccgaacttcagaag
cagtttcagtggatcattgatgaccccagtgaaccgatggaaggggaggagcatctaccc
gcccttacggctggtgataggatcccttgggcactggctcggcagaggttcttcacacga
ggcgtcaacaagatctccctgagggccatcgacaccgccgcctttatggtcatccttgat
gaagaggaacaagattacgataccgaacctctgaagggaatactggccaatcaaaccctg
ccaccgtggtataaagggctccctcaggaatccacagacagccagtttccaacacctctc
aaagatgactggaaccagaatcgtaagctagataagttcagccactccttgctcgctggt
aatggatataaccgttggtttgataagtgcttcaatctggtcatcttcaagaatggacgc
atgggtgtgaatgctgaacactcgcttgcggactcacctgtcatggctcacctgtttgag
tacgcctttggtgaggacatcatggttattgggtacaatgctgacggttcctgtaagggg
gaagtgaaagccacctatgcaccccccgtgcatctcaagtgggaacttccagatgaggtg
agaacggtgatggagaccagcttggagacggccaagaagattgcagacgatctggatttc
cacctgctggtccacaaccagtttggcaagggggccatgaagaagtgtaaggtcagccct
gatgccttcattcaaatgggcatgcagctggcatacttccgggatgctggtaagttcaac
ttgacctatgaggcatcgatgacgcgtctgttcagagacggcaggacggagaccgttagg
ccttgcaccatcagctcctgtgactttgtgaaatgcatggaagatccctcttcatctaaa
gcgcagcgtcttgccgcgttccggaaggcgtgtgatgcccatgtggctggttaccgcgat
gccatgtgcggcaagggcatcgatcgtcatctcttttgtctgtacgtcgtctccaagtac
ttgaatgaggagtctccattcttgcagaaggtgttgagtgaaccctggcgtttgtccacc
agtcaaacacctcatcagcagatgaacaaactggacatcaccaagcaccctgagtacata
tcagctggtggtggattcggtccggtggctcgcgatggctatggagtgtcctatatcatt
gctggtgaggacgtcgtcttctaccatgtctccagcaacaattcctcagctagtacggat
tcctggcgatttgccaagggcatcataaaagcaaacagagacatcctttctcttttccag
taa

DBGET integrated database retrieval system