KEGG   Acanthaster planci (crown-of-thorns starfish): 110985846Help
Entry
110985846         CDS       T05078                                 

Definition
(RefSeq) titin-like
  KO
K12567  titin [EC:2.7.11.1]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aplc01001]
    110985846
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aplc04131]
    110985846
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:aplc04812]
    110985846
   04147 Exosome [BR:aplc04147]
    110985846
Enzymes [BR:aplc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110985846
Protein kinases [BR:aplc01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   110985846
Membrane trafficking [BR:aplc04131]
 Others
  Actin-binding proteins
   Others
    110985846
Cytoskeleton proteins [BR:aplc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     110985846
Exosome [BR:aplc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110985846
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 I-set Ig_3 ig Ig_2 Pur_ac_phosph_N V-set fn3_2 Pkinase C2-set_2 Izumo-Ig Pkinase_Tyr Receptor_2B4 Ig_5 THB Ig_4 Kdo APH
Motif
Other DBs
NCBI-GeneID: 110985846
NCBI-ProteinID: XP_022102938
Position
Unknown
AA seq 16543 aa AA seqDB search
MESERSVDIEIEGTAPTEAVSFEISSGEVSVEGLPTEDKAVVIRALPSQPAPKEKEERLL
SVTEEEFEIATTVKVAPSEELEAEELEVFEESQPVPDQKPGTEAVTVEVGKMPSVIRVDS
VERVPLPVRERMESYPEEELSEASVIKLVPEREEEAEVLPEEELDQAAAEKIKEVPADKA
VKKIVQPKEAPEEVSLIQPRKPLESMTEEELQEAVTVELAPRDEYEAEKITPEQPAKLRP
QKSVEEVVPLDQVEKQKASVIRGPAEMTAAPSIPTVERLGSVSEEELAEATTKQYIPDDI
EEAAELPESVTVDVTAEEISEVGVTVSSVSKKKPALITATPQEVELTKKPSPDSQEAIIS
LKRLGSVTEEELREAAVKPFPEKEEEAEVFVSDEVTEAVPQELPSEAADKAGKRVPSVRT
APEEVAIVKPVKKPVAVREEDKEQIDLVYERTEYLDVVEEEDLKEAASKQLPFEKEGEAE
EFVVGEVPKAKPEEVPSEDVSLEVVSKKKPLPVREAPEEVTVTKPRPKLDSYEEEELQEA
AVVRVASEVVEEYEDLPIEETEAYSPETATAAVDRASKKQVPLREAPEEVTLEQPKARMA
SFDEEDLKEAVSISVTPRKEEEAEVLVDLAKPEETKSESMPSVDVSLEVSKKPAFVREAP
EEVQVRRPLAKMESVEEEELREAVTVRAVPQKEEDLDVVAPVEIPEEVAPVEKDIPGTVY
ERKPVVISHPYEPEPEYLPSRELLETLPEEQLETAVTARIIPRDEFKAEALPSEEVSPAA
ATPDKTPGEISLDVGKKPLVHSIPEVEKGPQLLEVEGITVEDLESQEAMEVVVEEEGKAV
ELPVAPVITDKFKSKSVKEGKPVKFTCTVTATPDTKIQWFHEQKLLESTTRHIQTFEEGV
ATLEIPQPRPKDVGEYKCIVVNVAGEDVCSAKLTVTEVKQAPSFTEKPEVPETPETTDAV
FRCKVDGFPKPAVTWNKGWKQIKTGGRFSISFDEDTEESILTIKETTSADAGKYTCYLKS
PLGEDSASVSLKITEKPKEELAEQVPVEELEEVEVLMEISKPKEISPEVVPVKGPEEILP
EKKPTVREAPEEVEKVLKPQVSLDAVSEEKLEIAGVAKVPDTEHVQILVETGKPEEVVVE
LAEAPIEVTPEKKPAVISVPEEVVAKVPATQTAMEAVVEEQLETAVIAKFVPNEEDEVDV
LAEIKKPEEITPAVVSIEEAPEHIKTKKKPSFIIASEDEVSIKPKPKLALEGVTEEKLET
AVTAMVAPQPEEQVEVLAAFMKPEEAVQTEEEIPKEVKPEEKPAIISTPEEVVAAAPAPQ
EYLEIVAEEELETAVTRVAPQPENEADLLPAVQKVTPTEAVEAITPSEVTLDVPEKPPTL
RGLPEKEILPEQLLEAEVFPEEEMEKHEAVEVVVEEEEKVEVMPVAPVITHKFKSTTVRE
GKPVKFVCTVIGTPKPEIKWFLNKEVLEASARFIQTFEEDVATLTIEHPKPKDAGEYKCV
VINSAGEDICNAKLTVTEIKRGPSFTKKPQVEDTPEGTEAVFRCKVDGFPKPTVTWNKGW
KQITTGGRFSISFDEDTEESVLSIKDTAPSDAGKYTCYLKNPLGQESSTVSLKITPTPEE
QLEEDEVTPKPEVKPEEWALVHEVEQVEVIPQVSKPEEVTPEVVTVEEVEEKPKAVEAVV
NEQAETEVAFKVRPHVSEEVVLPVSTEPEQITLEIVPEITPKPEEKPEEEDKPEGKPKEP
NSLKIPEQIEVILEVPKPEEVPTEMVALQEIEAQPEETDKVHTSKVDIEAVVEEQAETEV
TFKVKPLVKEEVVLPVSTEPEEVSVEVVLEEETKPEEVPERKPTFTVSSEEEVSKVFKPT
VSVKAEEQVDSAVTAQFKPRQEEEVEVQAAFKRPEEEIPAAVPVKIAAAKPKPTFVEEEL
PYAAQAYPEKLEGLPEEELETAVTKHVVQPTDEAGVLPSREEVVPLTATTKLAPTEVLDI
SEKKPEKIRGFPEKEAVPEELEEVEAIPEVTLGKLEAVETVVESEEKVEELPVAPVILHK
IRDKSTKEGKPVKFTLTVTGRPQPEVKWFLNKELLEASARYIQTFEEDIATLTIEHPKPK
DAGEYKCVVVNTAGEDICKAKLTVIEVKRGPSFAEKPQVEDTPEGNEAIFRCKVDGFPKP
EITWNKGWKQITSGERYAITFDEDTDDSVLTIKDTTPSDAGKYTCYLKSPLGQDSSTVSL
KVTPKPEEKPEEEDKPEEKPEEKAPVPEVEQIEAVPEVLKPEEVPTEVISVEEVEAVPEE
KPKVPSAKVDIEAVAEEQAETEVTFKVKPHVKEEVVLPVSTEPEEVTVEVVPKEETKPEE
VPERKPTFTVSSEEEVRKIFKPKVSVKAEEQVDSAVTAQFKPHQEEEVEVQAAFKRPEEE
IPAAVPVEKAAAKPKPTFVEEELPYAAPAYPEKLEGLPEEELETAVTKHILQPTDEAGEL
PPAEEVVPIEATPKLTPTEVLDISEKKPEKIRGFPEKEAVPEELEEVEVIPEVTPEKLEA
VETVMEREEKVEELPVAPVILHKIRDKSTKEGKAVKFTCTVTGTPQPEIKWFLNKDLLEA
STHFIQTFEEDVASLTIEHPKPKDAGEYKCVVVNTAGEDVCKAKLTVIEVKRGPSFIEKP
QVEDTPEGNEAIFRCKVDGFPKPEITWNKGWKQITSGGRFAITFDEDTDDSVLTIKDTTP
SDAGKYTCYLKSPLGQDSSTVSLKVTPKPEEKPEEEDKPDEKPEEKAPVPEVEQIEAVPE
VLKPEEVPTEVISVEEVEAVPEEKPKVPSAKVDIEAVAEEQAETEVAFKVKPHVKEEVVL
PVSTEPEEVSVEVVLEEETKPEEVPERKPTFTVSSEEEVSKVFKPKVSVKAEEQVDSAVT
AQFKPHQEEEIEVQAAFKRPEEEKPAAVPVEKAAAKPKPTFIEEELPYAAPAYPEKLEGL
PEEELETAVTKHILQPTDEAGELPSAEEVVPIEATPKLAPTDFLDISEKKPEKIRGFPEK
EAVPEELEEVEAIPEVTPEKLEAVETVMEKGEKVEELPVAPVILHKIRDKKVKEGTPMKF
TCTVSGEPKPEVQWFRDGTLLQPSSKNIQTFEADTAVLALPKPKPRDAGEYKCVAINPSG
EDYCTATLIVQEIRKAPSFEEKPTVPSTPEGTDAVFRCKVEGSPKPEVSWSKGWKQIKPG
AKIDITFDDTTQESVLTIKDVKPSDAGKYTCKLSNQLGEEKADVSLVVTPKPKEEKIPEK
PEMKEEKKPEEKVEPLPTEEMKPAKLEEMPAEVTPEKIIPVTKAEVETAPTQEPEGPAKF
VAKPGAFVESIEDEDAMITYEISDDMTDVKWFREGEEIQEGEKFAFKKDGRRRSLVIKDA
TLEDKARYMCVLPEDKAGTKLFVKETVHIVNIPEEMTIKEADKGMLKVEFNKDVSRKRVT
FFKDGKELKSSKKYKIVRKENTATLTINDVVPEDAGEYTVTAEEVKATVTMFVEEKPKPN
PPIFVQVPKALDIIEGESATFRFKVSGTPAPTIQWFKGWREITPGDQFSMTYDEETDEHR
FIIHSVTIKDAGKYQCQLVSENGQTKYGVSLMVQEKPAEEAPFVVPLKRRPSQEVKQQEE
IDIMALLRGIEPKDYEKVLREAGVYDFRAILKHLKMMQKEMEIEEEPVYEVLAEGDEIEE
VEALQIESPIFSVAPAPTVLSRAAEPPKEEFLFVEELEPVNVAPSETAELICTVSNEAAK
VKWFCGDEEILIDDGKYKTKQEQRRHSLIITDVTTEDAGKYLCAMGDKITSTLLTVTAEM
PEILKDLQSQKADESEDVEFTCELTDDLPEDVDVTWFKADTEIEPSVKYELKKDKRRLSL
VVHDLKKEDQAAYTVAIGERRSSATLQVKAFTLTPLQDTKATEFDKTATFECTVSSEKAV
VTWLKDGEKIEAGPKYEIQEDGTQRVLIVHNISPEDRGNFSCVVGDVESVAALSVEATKI
TKPLRETETTEKETVTLTCEVSHEKGVVKWLKDGKDLPDSPRYKTKAEGKVRSLVIEDVQ
RDDEGDYTCVVGDDKTTAGLFVKPPPVEFLTELTPIQVTERQTAEFVCEVSDEKAEVTWL
RDGKPVEPSDKYLIVKQGRERRLSVTNTEFPDEADYSCVIGDRKTTAELLVDEAEPEIVV
SMQDVKVTEDQEATFVCELDKDTSDVVWLKNGKEIEEDDTKFEVQRKGRRHSLIVKDIGL
DDAAAYTCVVGRKESSASLIVEEKPIEFTEPLQPLRASPGDSTTFECTLNKDNVEVVWMR
NDKEIKPSDHFEIKKDGKHHKMTVKGVQFEDDAEYTVKVKGAESKSSLVVQAPPKIEIDT
DKLTVTIKAGSKIVIEATVIGSPKPTTTWSKDGTELHPDKRITMTADNTMRAKVKLTIDK
SERTDLGEYTILAANDLGSDTVIVKVIVLDKPQPPNNLRITGITPTTVSLIWEPPEDDGG
SPVTEYIIEKRDMKRATWSKAGTTTSAELGFTVMKLLEGNEYLFRVIAVNKHGQSEPRVL
GSPVIAKHQFDVPHPPAKPQISDIDKTKMTITWSPPEFDGGSEITGYILERQEVGRDRWA
KVHKVPLTDTMFSCTDLIEGKEYIFRVMAENKAGLSKPSKPSDTHMAKPPYDVPGAPSKP
QPENIDVTTISITWNSPESDGGSPVTGYIIERCDVSRGRWVRANREKVTELTFKVTDLVE
GNKYQFRVSAENLAGVGTPSEPSDTIVAKLPFDVPGAPEKPTVSDIDSTKMTVNWSPPSA
DGGSPVTGYILERKEKTSSRWTKVTREPVTETALTVKELIEGKEYEFHVAAVNKAGSGPF
SSPSEPRTAKPPYDVPGAPERPAVSDVDSHQMTVTWETPSVDGGSPITGYILERKEKTSS
RWMRVTKETVIEKTLTIKDLNEGKEYEFRVAAVNKAGMGPFSKPSEQQKAKPPYDVPGPP
ERPTVSDVDSTKMTVAWTAPSVDGGSPVTGFIVERKDTTSTRWMKVTKEPISETNLIVKD
LIEGKEYEFHVAAVNKAGTGPFSAPSEPRMAKPPYDVPGAPEKPEVTAVDRTQITITWSP
PESDGGSPITGYIVEKKETSSTRWTKAQRDSVTETTLTVKDLIEGKEYEFHVAAVNKAGT
GPFSAPSEPRITKAPYDVPGAPDKPEVTAVDRTQITITWLPPESDGGSPVTGYIVEKKET
SSTRWTKAQREPITATLLTVKDLIEGKEFEFRVAAVNKAGTGPFSASSEPRITKPPYDVP
GAPERPQVTAVDRTQITITWSPPEYDGGSPVTGYIIEKRERSSTRWTKAQRDSVTETTLT
VKDLIEGKEYELRVAAVNKAGTGPFSAPSEPRITKPPYDVPGAPEKPEVTAVDRTEVTIT
WSPPESDGGNPITGYIIEKKETSSTRWTKPKRDSVTETTLTMKDLIEGKEYEFRVAAVNK
AGTGPFSAPSEPRITKPPYDVPGAPERPEVTAVDRTQITITWSPPESDGGSPITGYIVEK
KETSSTRWTKAQREPVTAKTLTVKDLIEGKEYEFHVAAINKAGMGPFSKPSELQKAKPPY
DVPGPPERPTVSDVDSTKMTVTWTAPSIDGGSPVTCYIVERKDTTSTRWMKVTKEPISET
NLIVKDLIEGKEYEFHVAAVNKAGTGPFSAPSEPRIAKPPYGVPGAPEKPEVTAVDRTQI
TITWSPSESDGGSPITGYIVEKKETSSTRWTKAQRDSVTETTLTVKDLIEGKEYEFRVAA
VNKAGTGPFSAPSEPRITKPPYDVPGAPEKPEVTAVDRTQITITWSPPESDGGSPITGYI
VEKKETSSTRWTKAQREPITATTLNVKDLIEGKEFEFRVAAVNKAGTGSFSAPSEPRITK
PPYDVPGAPEKPEVTAVDRTQITITWSPPESDGGSPIIGYIVEKKETSSTRWTKAQRDSV
TETTLTVKDLIEGKEYEFRVAAMNKAGTGPFSAPSEPRITKPPYDTPGAPGKPEVTAVDR
TQITISWSPPESDGGSTVTGYIVEKKETSSTRWTKVQRDSIRETTLIVKDLIEGKDYEFH
VAATNKAGTGPFSAPSEPRTAKPPYNVPGPPGKPDVIEIANTSMTLTWTAPESDGGSPIT
GYIIERKDRFSSRWLKVKETSISETVYTVIDLKEGTEYQFRVSAENKAGIGKPSEASDKT
VAKPPYDAPGSPGIPEISDVDCTHMTLTWTPPTDDGGADILGYIIEKCDADRKRWVKAHK
EDLITDLTFTVLDLVEGTNYMFRVSAENIAGIGESSEAAGPQKAKPPYDVPDAPNSPDVS
NIDKTSVLVTWSPPEHDGGAEISGYIVERRDAGRDRWVKTHKTPLMDNSFTATDLIEGKE
YEFRVSAQNKAGVGEPSAPSIAIKAKLPYDVPDAPGIPKISDITESSMKLDWTVPKSDGG
KDITDYFIEKKDRFSPRWSKVTQVPSTDTCCTVDGLKEGNEYQFRVIALNKAGAGKPSDS
SKPTAAKSPYDVPGAPSAPFISDVTATSMTLNWTPPHSDGGTPITGYTIERKDKFSSRWS
RITKEPVSETTFKVSGLKEGDEYQFRVTAENIRGAGQPGDACSFVKAKPPYDIPGKPPAP
KVTDIDSSQMTVTWSPPESDGGSSITGYTLEMRDTSSTRWVKAMRESITETTFTVKDLKE
GTEYEFRVTAENKAGAGKPSDASKAQVAKSKYDVPGAPGKPVVSDITAVSMTISWSPPDS
DGGSPVTGYILEKRDVSSKRWLKVSSETITDLSFDVTGLTQGSSYEFRISAQNKAGTGKP
SVPSDVTVAKPPYDVPGAPSKPEPSNVTETTIHLKWSPPKSDGGSPIISYIIEQRESFAR
SWTHALETKMIHVECTVSCLKQGTEYQFRVSAKNKAGVGNPSEPSNPIVAKLPYDVPSPP
ENVKLSIVSPTSIQLTWSIPSSDGGSPITGYFIYKKDAFSPRWSQITSELIEETTYKVKA
LEEGSEALFHVTAINNAGESKPSETVALKIQPPGAPDAPKIEKIDNKSAVVTWSAPDNTG
GSPITGYYLERRDTAKDRWVKVTRGAIKEMPFEVKDLVKDAEYEFRVSAENKAGIGEPSQ
PSKRAVAKLPYDLPGAPSRPEITTVDKTEITLTWNPPESDGGAPITRYILEKKDQFSSRW
SEVNKVTNTEYKVKGLKEGSEYQFRVSAENKAGVGKPSEPSQSKVAKLPFDVPESPKNLT
IFDQKPTSLTLSWSAPATDGGSPVTGYVIERKDKVSSRWTRVNTSSIEETSFSVTGLQEG
TEYEFRVIAENKAGLSKPCDSVALKIHPPGAPDSPKIEKIDNKSAIVAWSAPDSTGGSPI
TGYHLERRDTAKDRWVKVTRAAIKEMTFEVKDLVKDAEYEFRVSAENKAGIGEPSQSSKR
AVAKLPYDVPGAPSKPEITSVDKTEMALTWTVPESDGGSPITRYILEKKDQFSSRWSEVS
KVTNTEFKVTGLKEGSEYQFRVCAENKAGVGKPSKPSEIKLAKLPYDVPGAPGTLEVSDI
KPTSLSLTWTPPECDGGSPVTGYVVEKKDKFSSRWTKATITSVQDTTFSVLGLQEGTEYE
FRVSAENKAGLGKPSNPASLEISPPSAPGKPDVSEVTDKAVMVSWSMPKSDGGSKILGYI
VEKCDTSRDRWVRVSRSLLKETTLQVEELTVKTKYQFRVTAENKAGSGPASEPSDIVEAK
LPYEIPMSPDRPSVSDITANSMTLSWSAPTSDGGSPITSYVIEKKEPYGKWTQVAKTDGD
SHKVVGLKGGQKYEFRVAAENKAGRGSFSEATALTEAKEPYVVPDAPGTPDISDIKPSSL
KLSWTAPDNDGGSPIIGYLIEKKDKFSSRWTKVNISSIIERKFNVTGLQEGEEYEFRVTA
ENKAGLGKPSNPATLKVSPPSAPGKPELSDITNKAITLKWSVPESDGGSRITGYFIEKCD
TSKERWVKINRTVVKETTLRVEELTAKTEYQFRVSAENKAGTGPAGEPSEAVIAKLPYDI
PKSPTTPTISDITSKSITLSWDAPRSDGGSPITNYVIEKREPLGKWLQVAKTPDTSYTVK
GLKQGLEYEFRVAAENKAGIGSFSEASDATVAKEPYDVPGVPGTPDISDLKPTSLTLSWT
TPKSDGGAPITNYTIEKKDKFSSRWTKVNITSVTGTIFNVTGLQEGTEYEFRVTAENKAG
QGKPSSPAYLKITRPDAPGKPEVSDITNKSLILTWSAPESDGGSKILGYIIEKSDTSRDR
WVRVNRSLVKETTHRVEDLTAKTEYRFRVSAENKVGTGPTSQPSDAVVAKLPFDTPASPS
KPTVSNVTAHSMTLSWKPPTDDGGAKIKGYIIEKKEPFSTKWSPVSSTEDTSFTLTGLKE
GTEYEFRVAAENKAGVGAFSPATAPTMAKEPYDAPDAPGTPEPTDVTEHSTTLTWTPPAS
DGGSKVLGYIVERKDAYSTRWTRVTRDRVSETTLKVTDVKENSEYTFRVIAENKAGPGKP
SEPCAPVIAKRPYDVPGAPGTPSVSEITATSMTLSWTPPDSDNGSPITSYIIEKKEKFST
RWSRVNPLSVTDTTYLVKNLKEGDEYEFRVSAENKAGVSKPSQSAGPVVAKPPYDVPEAP
GKPKVTGTTAKTANITWSAPPSDGGSPIKNYVIERKDRFSTRWTVANRDEMVTETSYVVR
DLKEGEEYQFRVAAENKAGVGKPSELSELRVIKPAYDVPGAPEAPSISDVTSTTMTLTWS
PPEEDGGSPVTGYIIEKRDRFTTKWTKVNRYTVIETSFKVSELREGTEYEFRVAAENKAG
VGKFSEPSQKKVAKQPYDVPGVPGIPDISDIMATALNLTWTAPSSDGGSPITTYIVERKE
QFASRWSRINKESVTELTYKVTGLTEGNEYQFRVTAENKAGPGKPSQPTAMVIAKHPYGV
PSAPSTPTLSNVTSTSMTLTWSPPEFDNGSPITGYVIEKRDRMSTRWTRVNRETVTETAY
NVTGLIEGSEYEFRVSAENKAGIGEPSQPSRSTIAKPPYDKPDAPGQPTISNITASSMTL
TWTPPTLDGGSPITGYVIEKKDRFSTRWSRVNDYSIQDVEYIVSGLKKGTEYEFRVAAEN
KAGVGKPSESTGYKVAKPPYDVANTPGTPEITNIKPTSVTLNWSPPDSDGGSNILGYIIE
KKDKFSPRWTRVNTSLVEDTSFTVKGLSEGQECDFRIIAENQAGSSKPSNVSTYHIQPPD
APSGPDVSNIQENSVTLTWSPPQADGGSKITGYYVERRDVAKDRWVRVNRMPVKETRLVV
PDLMTNAEYEFRVIAENKAGLGKPSEPTQQILVKPPYDIPEPPSTPEVSDITKTSASVSW
QPPISDGGSKITGYVVEMKEQYSTRWTAAAKPRDTECKITKLSPGREYEFRVRAENKAGL
SEPSRPSASFVAKDAYDVPDAPSRPTTSNIQEHSVMLSWSPPASDGGAKISGYIIEMKEE
FTSRWTQINRERITDTEFTATKLKEGAQYAFRVSAENKAGVGKPSEPSATVTPKKPYGVP
DAPGKPKVTSSTSSSASITWSPPSSNGGSPITGHIIEKREDGMGPWTKCSRYEITETSFT
VRDLMEGSEYEFRVSAVNKAGVGKPSAPSDSVTTKPLYVAPNAPSIPEVTDSTSRSVSLS
WSKPKDDGGDQITNYIIEKKEPFSIRWTEVGRTPDTSFTVNGLKEGEELQFRVTAENKAG
PGKPSQDTGKVIVKPPYDVPDAPGKPTASDINSTSMTVNWTVPKSDGGSRIITYIIEIKE
QFSTYWKRVNPQEVTSTSFKVSSLKEGGSYEFRVSAENKAGVGKPSTVSETFIAKLPYDV
PSQPGAPDISNIQPTSMTLSWTAPTSDGGSPLTGYIIERCDTSSSRWVRVNKYTVKDLSY
TVTDLREGCEYKYRVSAENAAGISKPSEESTAKVAKHPYDVPGAPSRPQISHIDTTKMTV
SWSPPDSDGGSPITNYILERKDKFSTRWMRVTRDRISETEFTVQGLMEGTAYEFRVSGEN
KAGTGPASEPSESKVAKTPYDVPDTPGTPDVSDVTSSSMVLTWAEPFSDGGSPITNYIIE
KRDRYTSRWTRVNKYNITETTFTVTDLKEGSEYEFRVSAENRAGVGKPSEPSSLVKAKPP
YESPSSPAAPYISDITADSMTLSWSPPKTDGGSPITGYYVEKKDRFGLRWTRVNREPTQD
TTLRIPGLSEGEEYQFRVVAENRGGEGKPCEPTEPTVAKAPYDVPGAPSAPQITKVTEST
MSLHWAEPLFDGGTPILGYHIERKDAMGRHWTRITREPVNDVTYKATGLMEGSEYEFRVF
AVNKAGVGSPSNVSDVAKAKPPYDVPGAPGMPVISDTTSSSMHLSWSEPESDGGSPITGY
LIEKRERFSTLWTPVTKREVPEASYTVTGLTEGIEYEFRVAGQNKAGAGKFSEPTRPTVA
KPPYNVPGSPSSPEVTDITPNSMTLHWSPPASDGGSPITGYIVERKDTSKMGWTVANRVP
ISDTSFTVPNLREGTEYEFRVIAENKAGTGKPGVASQPKLAKAPYDVPDAPGTPQISNIT
ATSMTLAWSPPKSDNGSPVTNYILEMRQDFSMRWTKISASVLETTHTVTRLTEGSKYVFR
VAAENKAGPGQFSEPSDQAIAKPPYDAPGSPDTPTVSEVTANTALLSWSPPSDDGGAALT
GYVIEKKDKFSTRWTKVDEVNADATSFNVRGLSEGNDYEFRISATNKAGVGKPSDSSNRF
TAKAPYDVPDAPSAPTILESTNSSMTLSWAPPVSDGGSPITGYIIERHDLSTSRWIKAHR
EPLTDTTYTVRDLTADKKYEFRVSAENKAGVGRTSEPSAARVARPPYDVPDAPGKPQITK
TDSTEMTITWAPPASDGGSKIISYIIEKRDRFSTRWQKINRYSVTDTTFQATGLSFKMEY
EFRVSAENQAGVGKPSEPSDAAIAKPPYDVPDSPENVNVRETTSNSASLTWSPPHSDGGA
PITGYIIEKKDQYSSRWTRVNRIPILETEMTVPDLKEGFEYEFRVSAENKAGVGRISEPS
RPTVIKPPFKIPGTPSAPTISDITSTSMTLSWSPPSSDGGSPITGYTVEKQEPFSTRWTP
VETFTGTSGTVGGLREGTEYQFRVVAVNKAGNSKPSMSSQPRVAKPPYDVPGPPSTPSIN
ETTATSMTLEWSPPLSDGGSKIIGYVIQKKEKLALRWVPVNQLSIAETTYTVRDLVEKSE
YQFRILAENKAGFGPPSDSSETKMAKPAYDVPGQPEAPTVSDTTKSTIRLTWSPPLSDGG
SKITGYILEKREPFGFKYTRVTTRSIQETEYTLTNLREGSQYEFRVSAENKAGVGTPSEP
CRPVVAKAPFDTPSAPGVPEISDVTGTSLTLSWTPPAHDGGNPITGYTIERADRYSTRWS
PITKEPVRDCSYVVRDIPKGAMYQYRVVAVNDAGMGKPSDATDAKGPAVAPKLDLNKYRD
TLVVRAGTTFHLDVPYKAQPRPVVKWDKDGIPLVSSTRVKIETSDRETVLTAKNCVKADE
GAYKLSVSNSAGSENAIIHVQVLDRPSPPQGPLEILDMDSTFVTLSWHPPSDDGGSRVTH
YAIEKRDMKRTSWSRLPVHVSNTTHRVQNLMEKAEYGFRVIAINKIGESEPLEGTEKILM
KSKYEVPGAPSTPQVTDTTADSVSLSWLPPSFTGGAEIIGYVIEKKDRTSIYWSKVAKLD
GDETSCIITRLTRGGEYQFRILAENRVGVGAPSEPSIRVKAEEAAVTPKLGEVKEPITAK
VGTTVRVEVPYTGFPVPRTTWTREGASLPSSQRMKVETTDRAVAMIIKNCERSDAGNYTV
TVKNDAGSDSTKIEIKIFDKPSPPRGPLEQTDVTENAVTLSWRPPQDDGGSRIFNYIVEK
QGESDYKWKPVTEKNITDLTYRVTGLKEYKRYQFRVMAVNQFGTSEPLEGQAVMPKGQYN
VPDAPDAPDVSNITVDSMTLSWSPPLHDGGAPVTGYVVEMRQTTSPRWVKATLTPIPDTT
FKVSRLLRGSEYEFRVSAVNRAGTGNPSEPSQSVIAENPPVPPKLDLDLKYQRVITVRAG
TSFRVEVPYKGTPVPTIKWMHNSLSQVSRLLRGSEYEFRVSAVNRAGTGNPSEPSQSVIA
ENPPVPPKLNLDLKYQRVITVRAGTSFRVEVPYKGTPVPTIKWMHNSVPIERTLRVSIET
NDFGTVLNTRNSEREDSGDYVITATNKAGEASATLTVKVFDRPGPPEGPLQVVRLGSNDV
TLSWSPPSDDGGSQIVGYILEKREGSMRMWSKVSAALTECMHRVIGLTEGNEYQFRVRAE
NKSGVSEPLEGEKVIPKGDYEVPGKPGPVSISSIHGDAVSLNWSPPSKDGGAPISGYIIE
KRDRASDAWSRVNAAPITDSSYKVPRLIQGTEYDFRVSAVNKAGVGEPAATPGPVLVERP
AAAPKLEPGAVYRDIIKVRAGSNLHMDIPCRGKPTPTISWTKDGSEIAIDAIRVRASTND
FATNLTVKNTGKADAGTYVVRATNKAGSDSATIKVVVLDKPGPPEGPLNTSDITKDSVTL
SWQPPTDDGGSQVTNYILEKREADRLTWTRVSATIRGTRYTVTSLIDGTKYMFRVRAENK
YGQSEPLNSTDAVLVKSPFDVPDAPGTPEVSGITDTTMTVSWKPPRSDGGSEITGYILEM
KETTGVRWMRATRKVLKESNFTVTNLVKGREYEFQVAAENEAGVGPMSRKSTSACAKTPV
ETAEFTEPLTDISAKVGKTVTLECRISNAKAEVKWLKDGVQIFAVDRHSIIKEGQRRALV
IRDVGPRDIGKYTCKCGDASTEATVKVKAEPKIDLSDYKDVITVRAGNVLRLYVPFTGCP
TPTAEWYRHDRRISEDSRTKIEKQENRTELVIKNTIRSDTGQYSLTVSNEAGKHTANIHV
IVVDVPGPPTGPLEISDVGRFSVNLSWSPPREDGGSKIEYYTVERREKGRKLWTVATTYA
TTTSFTVTGLGENMEYEFRVSAENINGVGPPLESSQAVVCKTPFSVPSAPGKPEVHNICH
DHMTLTWTEPQHDGGKPITGYILEMRENFGAHWKRVNRESVVDTTYTVKGLVEGHQYDFR
VTAENTVGPGKPSQPTHPPRIAKDPARRPSPPGCPTIKDITSTSVKLSWTVPFSDGGQPI
THYTVERRRKGSYDWTDKLTTPTNSCQVEKLSPNVEYVFRVCAVNTAGMESDPSKASEAF
VTRESLPGVPPTFTEEPHSTMVAEKTKAEFTCRVAGTPTPHVDWIRKGRELFTGRKYSIT
TDKDGLHRLTIHEARELDSGMYTAVAQNENGKVRASAELHIKSLPTLDLDRRMRDFSVRA
GSTLRISIPFTGTPTPILRWKKEDGEEINTRGRFRIDALGGEADLTIRETEREDSGVYIL
EAENEYGVQQVAAKVQVVDKPGPPTGPIQTVEVSKKSITLSWQPPADNGGSPIIRYIVEM
KEANRTIWQNVGFVSASTEHTVSGLMEGTAYLFRVSAENQYGPSEPLIGRESVMAKAPYD
VPGAPGKPSVSDIQRHSVHLLWVPPESDGGSPITNYIIEKQETTSTRWFRANREEVTGNS
HTITNLIEDSEYEFRVIAENKVGFSQPSPSSQRVIVKDPRGSIPASFVRTPQSIAVTQGR
AGTLECEVAGYPSPQVFWYRLGRELHDSRKYKIRASGNIHTLQINDVYEEDTGEITVKVM
NKAGSQTEKADLQIQVAPKVNVPPRLRIPLDCLQGEILKLRIPYTGIPAPSITWDHDGVD
IKPARNLEIKTSDKETMLSITTVSKEDAGKYTVVATNELGYDSASIVINILRQPDPPRNL
EVLDVTSDTVRLSWQPPLHDGGSTITSYVVEKRDAGSNTWVRCVTSRNCFHTIVGLRSES
EYQFRVTALNSFGASEPCEASTVIATKPSALTRPELEDYEAKRRFYDSLVDLSWIPSRFD
YIKRFGSVYDYYNIYEELGRGSYGVVYRAVEKKTGKTFAAKFLRCQGHEREVVKREIDIM
KRLHHPALLSLHEVFENDEEIIMIIEFLSGGELFDRLVDESHILTEPEVVDYMKQICEGI
RHMHEKHILHLDLKPENIMLRTRTGNDVKLIDFGLARELDPHEQVRVMFGTPEFVAPEVV
NFEPIGLPSDMWSLGVLAYVMLSGISPFMGESDIDTLKGVSRGEWDFDEEAFADVSDEGL
DWIEKILIQDKDKRMTIQEALAHPWLNMETDTLARRRARRLNTRRLRKLHEKRKPEGAGE
TINALGRLAHGGALREIHKVYRGMPLHERLVYMDVRDAAPKFVVPLETTTAIEGNAARFE
CEVSALTEPLITWYKGKTPLQIGIKYKMLYDDRKYTLVVQDTNIDDVGEYTCKAVNSYGS
ATSSASLDIELLDEEELERRGERRTLEMKRQKIPLGERARRLRAMQAEMGADQPPQFVKT
LQDKECGLGFILPLSFEVTVPPEPTKVIWYLNGKQLKEGPRYKFYVDNGTYTLEVQETTL
DDMGEYCAEVTNQTGTSVTKCQVAVDENFMDKYAGYVRPHFVQRLRDILIVEGSAARLEC
KVNGMPDPDIRWFKDHKEIEDGVHYSMEFEDDDTCALILQDVFLTDAGTYTCQASNLLGR
ISCDSRVKVERCGAESEPASEPSRESSLEDLTTISKHIPARRRLNCAPFFSLPLRRKKVA
ENDSVRLTCAVQGYPAPKVAWTKDGNPIFDGYYYSITNRWGVCSLEVHSARLSDTGTYRC
TATSEEGQDSSACELVVEERMEPDETLDYIRPSFHKPVRGKRVKEGKTAHLDIQVSGFPE
PQIIWYKDNVRIDEDEHISIEKHPGGAQTLVITGVTPTDAGRYKAAASSPAGKASCAADL
IVLEVEADVESEDEGELGRGRGRRRTRRKPKEEPKEPKPHRKPQKVRPVPETFEERKARR
IQQRKEQPLLYRPSSVPVRSHRRSYSPSYMPAFGPPPLYSPTIDMRKQKPVPGYKPVPYA
RTPPLARAQSVPVPVVARTIPHPVVDDGYGPTYIPHYEIPKKGRHGEHKCPTPSYVPHHA
LPAKAVTPTPHDDRYFAALFEDILSASEYEFQQRERTPSFPRSRTPSVSRTRSITPTRRR
RTLSSDYEDLYGRRPSYEGKRTRSITPTRAGYITPSAPDYDAYMKKMKAIQKQPQAFRPS
SVPARQLPEIFTPVFDDEERIRPVPKRYPQPVRAKSVPPKEGRPVKKTDIERYHLPSLRE
FIGNRPHPFMPREKSVTTAPTPSRMSSTSEFEDHSVPHERRPRYDSQSSTSSYRGRSTTP
TARYGGRSVTPASDYGDKDYRRTSLDRPTPQSFRQRSKSPSMSTVPKRSRTPTTPEYERS
FDSFRPRSISPRAAVVLERGAKPPSSVHKHSYDAAQRRDMTPTFSDTQHRPRDMRLLSTD
SVESFDSRSRSPGLRRSVTPVGTDSERTPREIMIIERMSSYDSTSGRSISPTPEKRHREF
PKSSVKKSSASPTVSAPRRDSTPTYPDYRRREYSLSSSDIESFEAPRLRPASPRVTPHHR
QSTKPSDDAEQQQRDYQLLSTDSIESYSGRSPSPLHGRPVTPVGTDSLRTPREIRIIERL
SSYDSVRQSGISPVPGTRRSVTPSQEQLQRDARRPVSPRMPSSSAVYSDQKRSMTSSEQY
HRDYPIPSDRKSVETRARRPASPEVTRHHRRSVTPTSSDTERRHRDSRLLSTDSHESYSG
RPTSPHSGRPVTPVATDSLRTAREIKIISKLSSYDTPRESAMSPVLGTRRSVTPTYQRRP
SDVKRPVTPKTYASAQESSTPSAPRGTLASMSDVTTRKSYTSPRPASPRDVSHRDSRRER
ASYRQLLSEGESSETQLTPQPTSLLPERPVTPVATQSLRTAREIRIVDRISTRDRTTSPT
TRSKQRDYSLPSSQSTSAYSKPERRDYQSSSYASSTRSYDRFEPQHLYRQRSSSPVKRSV
SPISLGVQERDLYSSSSKKSYRDSYESSRSHRQRSPSPKVITTDYDRDYTSAGRRYDTDR
SFTEDSFRTTTSASRLSPTSAEDRYERSFDSYARSSKQKSSKGGAFAPVGVGKPGSAPKA
ELPFKLESDLLEESGSDHSSPARFIPLADEEGVEAIRLDTLEKAPDKPEAVTKDEVPIDS
KPTEEDAEPKEKEDVEDEKDEDSERLLAKKKQAMIETDQKIDDTEGDGPPEFVQRLRDMT
VNDGARVVLEVQITGARPMDVGWLRNGQDIPDSDEFHYVSRGNIHQLVIAEVFPEDSGKY
TCEALNDHGEADCQCTLNVIEEPSVSISINVSQDITATTTDHQAIMDDENIPPEFFEEPQ
SQTVEEGGMARFVCDVDGEPIPTVTWSKDDVPIRDGGRFRVYSDKFSHTFEIPVALATDE
GEYVCTATNKEGQTECGFSLRVIQDQTAAVADKQIIDATGPQSTPPVTSSEPIAIFAPVA
QSAPDQDSEVIAQFDDTMDAIGEPVRFSSDSEAPVFVEELQDQVVVEESGTNFQCRVTGK
PLPDITWFFEGRPIKSSKYFQMSEEDDMCILTIAEAYTEDAGKYSCHANNEAGEAVTSAM
LVVHEPAPPADITPSPAAESISQQAPSFDKKIQDCEAQANSEARFECTVKGTPIPETKWF
KNGKPLKEGIRHKLSQGADGVCSLVIPRAQIEDSGDYECNAQNANGGASCIAKLSVKSSK
KLPFLNKFQQDSSSSGSGPGGKKGPTGPSRGSSVMARAQMFGK
NT seq 49632 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtgagagatctgtggacattgagatagaaggcacagcccctacagaggcggtt
tcctttgaaatatcaagtggagaggtctcagtggaaggcctaccaactgaggataaagca
gttgtgatccgtgcacttccatctcagcctgcacccaaagaaaaggaagagagactcctg
tctgtaacagaggaggaattcgaaatagccactactgtcaaagtagctccctctgaagaa
cttgaagctgaagaacttgaggtgttcgaggaatcccagccagttccggatcagaaaccg
ggcacagaagctgtgacagttgaagttggcaagatgccatctgttatcagagttgactct
gtcgagagagtacctcttccagtcagggagcgcatggagtcgtacccagaagaagagctg
tctgaggcatctgtcatcaaattagttcctgagagagaggaagaagcagaagtcctgcct
gaagaggaactagaccaagcagcagcagaaaagattaaagaagttcctgctgataaggcc
gtgaagaagattgtccaaccaaaagaagcaccagaagaagtttccttgattcaacccagg
aagcccctggaatcaatgacggaagaagagcttcaagaggctgttactgttgagcttgct
cccagggatgagtacgaggctgagaagataacacctgaacaacctgcaaagctacgtcca
cagaaatcagttgaagaggtagtgcctttggatcaggttgaaaaacagaaagcctctgtc
attagaggtccagctgagatgacagcagccccctctatcccaactgtcgagaggctagga
tctgtctcagaggaagaacttgctgaggcaacaacaaagcagtatatccccgatgacatt
gaggaggcagctgaacttccagaatcagtgacagttgatgtcactgctgaagaaatctca
gaagttggtgtcacagtcagcagtgtgtccaagaagaagccagcattgatcaccgccact
ccccaagaagtggaactgacgaaaaagccttctccagattcacaagaagcaatcatttca
ctcaagagacttggttctgtcacagaagaagaacttagagaagctgctgtaaaacctttt
ccagagaaagaagaggaagctgaagtttttgtgagtgatgaagttacagaagcagtacca
caggagcttcctagtgaagctgctgacaaggcaggaaaaagagttccatctgtcagaaca
gctcctgaagaggtggccatagtaaaacctgtcaagaaacctgtagctgttagggaagag
gacaaggaacagattgatcttgtgtatgaacggacagagtacctggatgtcgtagaggag
gaagatctgaaagaagctgcctcaaaacaactgccttttgagaaggaaggcgaggctgaa
gaatttgtggtgggtgaagttcctaaggctaaaccagaggaggttcctagtgaagatgtt
tctttggaagttgtgtcaaagaaaaagccattgccagtcagagaggctccagaggaagtc
acagttacaaagccaagaccaaaactggattcatatgaggaagaagagcttcaagaggct
gcagttgtaagagttgcttcagaggtggttgaggagtacgaggatcttccaatagaggaa
acagaggcatattcccccgaaacagcaactgcagcagttgacagagcttccaaaaagcaa
gtgccactgagagaagcaccagaggaggtgacacttgagcaacccaaagctcgcatggct
tcttttgatgaagaagaccttaaagaagcagtttcaatcagtgtcacccctcgaaaggaa
gaggaagctgaagtcttggtagatttggcaaaaccagaagagacaaaatctgagtcaatg
ccttctgttgatgtttcattagaggtttccaagaagcctgcttttgtcagggaagctccc
gaggaggttcaagtaaggagaccccttgcaaaaatggaatctgtggaggaggaagaactt
cgagaggctgtgacagtaagggctgtacctcagaaggaggaggatttagatgttgttgcc
ccagttgagataccggaggaggttgccccagttgaaaaagatattcccgggacagtttat
gagaggaaaccagtcgtcatctcacatccatatgaaccagagccggagtatttgccatct
agagagttgcttgagactctcccggaggaacagcttgagacagctgttacagcaagaata
attcctcgagatgaatttaaagctgaggcactgccttctgaagaagtgtcaccagcagca
gcgacaccggacaaaacaccaggcgaaatttccctagatgttggcaaaaagcctcttgtc
catagcatacccgaggtagaaaagggtccacagctgttagaggtggaagggattacagta
gaagacttggagtcacaggaggccatggaggtggttgttgaggaagagggaaaagcagtg
gagctacctgttgcacctgtcattactgacaagttcaagagcaagagtgtcaaagaaggt
aaacctgtcaaatttacctgcacagtcactgccacaccggatactaaaattcagtggttc
catgaacaaaaacttcttgagtcaacaaccaggcacatccaaacctttgaagaaggagtt
gcaactcttgagatcccacagccgaggcctaaggatgttggtgaatacaagtgcattgtg
gttaatgtagctggcgaagatgtctgctcagctaagctcactgtcacagaagtcaagcaa
gctccttctttcacggaaaaacctgaagtccctgagacccccgaaaccactgatgctgtt
ttcagatgcaaagttgatggcttccccaagcccgccgtcacatggaacaaaggatggaaa
caaataaaaacaggagggcgcttctcaatctcatttgatgaggatacagaagagagcatc
ctcacgattaaggaaacaacttcagcagatgctggaaagtacacctgctacctcaagagt
cctcttggggaagacagcgcttccgtgagtctcaaaatcactgaaaaacccaaagaggaa
ctagctgaacaagtgcctgtagaagaactggaggaggttgaggttctcatggagatatct
aagcctaaagaaatcagccctgaagttgtacctgttaaagggcctgaagagatacttcct
gaaaagaagccaactgtaagagaagctcctgaagaggtcgagaaagttctcaagcctcaa
gtttctttagatgctgtctcagaagaaaagctagaaattgcaggggttgccaaagtgccg
gacactgaacatgttcagattcttgttgagactggaaagcctgaggaagtcgttgttgaa
cttgcagaagctccaatagaagtaactcctgaaaagaagccagctgttatttccgtgcca
gaagaggtagtggccaaagtaccagcaactcagacagcaatggaagctgtcgtggaggaa
cagctggaaacggcagttatagctaagtttgttcctaatgaagaagatgaagttgacgtt
ctggctgagatcaagaagcctgaggagatcacacctgctgttgtttccatcgaagaagct
cctgagcatatcaaaaccaagaagaagccatcattcattattgcctctgaggatgaagtc
tccatcaagccaaaacctaaacttgcacttgaaggggtcactgaggaaaagctggaaaca
gctgtaacagcaatggtggcacctcaaccagaagaacaagttgaagtcttggctgcattc
atgaagccagaagaagctgttcaaactgaggaggagattcctaaagaggttaagccagag
gaaaagcctgccatcatatcaaccccagaggaagtggttgctgcagcacctgcaccacag
gaataccttgagatagttgctgaagaggaattggagaccgctgttaccagagttgctcct
caacctgaaaatgaagctgatttgcttccagctgttcagaaggtcactccaacggaagct
gttgaagcaataaccccatcagaggtaactcttgatgtccctgagaaaccaccaactttg
agaggtttaccagagaaggaaatacttccagaacagcttttggaagctgaggttttccca
gaagaagaaatggagaaacatgaggccgttgaagttgttgtggaagaagaagagaaggtc
gaggtaatgccagttgcacctgtcattactcacaagtttaagagcacgactgtcagagaa
gggaagccagtgaagtttgtttgcactgttattggaacacccaaacctgagatcaagtgg
ttcctaaacaaggaagtacttgaggcaagtgctcgtttcatccaaacctttgaagaagat
gttgccacattgacaattgagcacccaaaacccaaggacgctggagagtataagtgtgtg
gtcatcaactcagcgggagaggacatctgtaatgccaaactgactgtcacagaaatcaaa
agagggccttcattcaccaagaaaccacaggttgaagatacccctgaaggaactgaggca
gtcttccgatgcaaggttgatggtttccccaaacctacagttacctggaacaaaggttgg
aaacagatcactacaggaggaagattcagcatcagctttgatgaggacactgaagaaagt
gtcttgtcaatcaaggacactgccccttcagatgctgggaagtacacttgctatctcaag
aaccctcttggacaggagagctcaactgtgagtctcaaaatcactcccacgcctgaggag
caactggaggaggatgaggtcactcccaagccagaagtaaagccagaggagtgggcactt
gtccatgaggtggagcaagttgaggtgatacctcaggtttcaaagccggaggaggttaca
cctgaagtggtaactgttgaggaggttgaagagaaaccgaaagcagttgaagcagtggtg
aacgaacaagctgagactgaagtagcattcaaggtcaggcctcatgtcagtgaagaagta
gttcttccagttagcactgagcctgaacaaattactctcgaaattgtcccagaaatcact
ccaaagcctgaggaaaaacctgaggaagaagacaaaccagaaggaaagccaaaggagcca
aattctttgaagattccagagcaaattgaagttattctcgaggttccaaaaccagaggag
gttcctactgaaatggttgctttacaagaaatagaagcacaacctgaagagacagataaa
gtccatacttccaaagttgacattgaagcagtggtggaggaacaagctgagactgaagta
acattcaaggtcaagcctcttgtcaaggaagaagtggttcttccagtaagcactgagcct
gaggaagtcagtgtggaagtcgtcctagaagaggagaccaaacctgaggaagttcctgaa
aggaagccgaccttcactgtgagttctgaagaggaagtcagcaaagtttttaaacctaca
gtttctgtgaaggctgaggaacaggtggattcagcagttactgcccagttcaagcctcgc
caagaagaagaggttgaagtgcaagctgcatttaagagaccagaagaagaaatcccggca
gctgttcctgtaaaaatagcagctgctaaacctaagccaacctttgttgaagaggagctt
ccttatgccgctcaagcctatccggaaaagttggaaggtcttccagaggaagaactagag
acagcagtcactaaacatgttgtacaacccacagatgaagctggtgtacttccttccagg
gaggaggtagttcctttgacagctactaccaaattagcccctactgaggtcttagacatc
tctgagaagaagccagaaaagatcagaggctttccagagaaagaggctgtgcctgaagag
ttggaagaggtagaagccattccagaagtaacattagggaagctggaagctgtggagact
gtcgttgaaagtgaagagaaggttgaagaacttcctgttgcacctgtcatcctccacaag
atcagagacaagagcaccaaagaagggaagccagtgaaatttactctcactgtaactgga
agaccccagccggaagtcaagtggttcttaaacaaggaacttcttgaggcaagtgctcgt
tacatccaaacctttgaggaagatattgccacattgactattgagcatccaaaacctaag
gatgctggagagtacaagtgtgtggttgtcaacacagcaggagaagacatctgcaaagcc
aagttgaccgtgattgaagtcaaaagaggaccatcatttgccgagaagccacaggttgaa
gatacacctgaaggtaatgaagccatattccgatgcaaggttgatggtttccccaaacct
gaaattacatggaacaaaggttggaaacagattacaagtggagaaagatatgctatcacc
tttgacgaggatactgatgacagtgtcttgacaattaaggacacaaccccctcagatgct
gggaagtacacttgctatctgaagagtcctctaggacaggacagctccacagtgagttta
aaagtcacacctaagcccgaagagaaacctgaggaagaagacaaaccagaagaaaagcct
gaggagaaagctccagtcccagaagttgagcaaattgaggcagtgcctgaggttttgaaa
ccagaggaggttccgaccgaagtaatttctgttgaggaggtcgaagcagtccctgaagag
aaaccaaaggtcccatcagccaaagttgacattgaagcagtggcagaggaacaagctgag
actgaagtaacattcaaggtcaagccccatgtcaaggaagaagtggttcttccagttagc
actgagcccgaggaagtcactgtggaagttgtcccaaaagaagagaccaaacctgaggaa
gttcctgaaaggaagccgaccttcactgtaagttctgaagaggaagtcaggaaaatcttt
aaacctaaagtttctgtgaaggctgaggaacaggtggattcagcagttactgcccagttt
aagcctcaccaagaagaagaggttgaagtccaagctgcattcaagagaccagaagaagaa
atcccggcagctgttcctgtagaaaaagcagctgctaaacctaagccaacctttgttgaa
gaggagcttccttatgcagctccagcctatccggaaaagttagaaggtcttccagaagaa
gagctagagacagcagtcactaaacacattctgcagccaacagatgaagctggtgaactt
ccacccgcagaggaggtagttcccattgaagctactcccaaattaactcctacagaggtc
ctagacatctctgagaagaagccagaaaagatcagaggctttccagagaaagaggctgtg
cctgaagagttggaagaggtagaagttattccagaagtaacaccagagaagctggaagct
gtggagactgttatggagagagaagagaaggttgaggaacttcctgttgcacccgtcatc
ctccacaagatcagagacaagagcaccaaagaagggaaggcagtgaaatttacttgcact
gtgactggaacaccccagcctgaaatcaagtggttcttaaacaaggatcttcttgaggca
agtactcatttcattcaaacctttgaggaagatgttgcctcattgactattgagcatcca
aaacctaaggatgctggagagtacaagtgtgtggtcgtcaacacagcaggagaagatgtc
tgcaaagccaagttgaccgtgattgaagtcaaaagaggaccatcatttatcgagaagcca
caggttgaagatacacctgaaggtaatgaggccatcttccgatgcaaggttgatggtttc
cccaaacctgaaattacatggaacaaaggttggaaacagattacaagtggaggaagattt
gctatcacctttgacgaggatactgatgacagtgtcttgacaattaaggacacaaccccc
tcagatgctgggaagtacacttgctatctgaagagtcctctaggacaggacagctccaca
gtgagtttaaaagtcacacctaagcccgaagagaaacctgaggaagaagacaaaccagat
gaaaagcctgaggaaaaagctccagtcccagaagttgagcaaattgaggcagtgcctgag
gttttgaaaccagaggaggttcctacagaagtaatttctgttgaggaggtcgaagcagtc
cctgaagagaaaccaaaggtcccatcagctaaagttgacattgaagcagtggcagaggaa
caagctgagactgaagtagcattcaaggtcaagccccatgtcaaagaagaagtggttctt
ccagtaagcactgagcccgaggaagtcagtgtggaagttgtcctagaagaggagaccaaa
cctgaggaagttcctgaaaggaagccgaccttcactgtgagttctgaggaggaagtcagc
aaagtttttaaacctaaagtttctgtgaaggctgaggaacaggtggattcagcagttact
gcccagttcaagcctcaccaagaagaagaaattgaagtgcaagctgcattcaagagacca
gaagaagaaaaaccggcagctgttcctgtagaaaaagcagctgctaaacctaagccaacc
tttattgaagaggagcttccttatgcagctccagcctatccggaaaagttggaaggtctt
ccagaagaagagctagagacagcagtcactaaacacattctgcagccaacagatgaagct
ggtgaacttccatctgcagaggaggtagttcccatcgaagctactcccaaactcgctcct
acagatttcttagacatttctgagaagaagccagaaaagatcagaggctttccagaaaaa
gaggctgtgcctgaagagttggaagaggtagaagccattccagaagtaacaccagagaag
ctggaagctgtggagactgttatggagaaaggggagaaggttgaggaacttcctgttgca
cccgtcatcctccacaagatcagagacaagaaagtgaaagaaggaacacccatgaaattc
acatgcaccgtttctggggaacccaagccggaagtccaatggttcagggatggcactctc
cttcaaccttccagtaaaaacatccagacctttgaagctgacacagccgtcttggcttta
cccaaacctaaaccaagggatgctggcgagtacaaatgtgttgctatcaatccatcaggg
gaagattactgtaccgccacactgattgttcaagaaataaggaaagcaccatcatttgaa
gaaaaaccaacagtaccaagtacacctgagggtactgatgccgttttccgctgcaaagtg
gaaggctcccccaaaccggaagtctcttggtccaagggctggaagcagatcaagccagga
gcaaagatagacatcacctttgacgatacaacccaggagagtgtgctgactatcaaggat
gtcaagccttctgatgctggcaagtacacctgcaagctgagcaaccaactgggagaagag
aaggccgacgtcagtctggtggtcaccccaaaaccaaaagaagagaagatcccagagaag
cctgagatgaaggaggaaaagaaaccagaagaaaaagttgaaccactgcctactgaggag
atgaagccagccaaactagaggagatgcctgctgaggtgacgccagaaaagattattcct
gtcactaaggcggaggtagaaactgcaccaacccaagaaccagaaggtccagcaaagttt
gttgcaaaacctggagcttttgttgagtctatcgaagatgaggatgccatgatcacttat
gagatcagtgatgatatgacggatgtgaaatggttccgggaaggagaggagattcaagaa
ggtgaaaagtttgccttcaagaaggatgggcgtcgtcgctcccttgttatcaaagacgca
acccttgaggacaaagccaggtatatgtgcgttctcccagaagacaaggcaggcacaaag
ctctttgtgaaagaaactgtccacattgtcaatatcccagaagagatgacaatcaaggag
gcagataagggaatgctgaaggtggagttcaacaaagacgtctcccgtaagagggtcacc
ttcttcaaggatggcaaggagctgaagtccagcaagaagtacaagattgtccgcaaggag
aacacggccaccttgaccatcaatgatgtggtcccagaggatgctggagagtatacagtc
acggcagaggaggtgaaggcaacagtgacgatgtttgttgaagagaagcccaaacccaac
ccgccaatctttgtgcaggtacccaaggctctggacatcattgaaggtgagtctgccacc
tttcgcttcaaagttagcggtactccagctccaacaattcagtggttcaaaggatggcgg
gagatcacacccggtgatcagttctccatgacgtatgacgaggagaccgacgagcatcgc
ttcattatccattctgtcactatcaaagatgccggcaagtaccagtgtcagctggtcagc
gagaacggccagaccaagtacggcgtctctttaatggtgcaagagaagccagcagaagag
gctccgtttgtcgtcccattgaagagacgtccctcccaggaagtcaaacagcaagaggaa
attgacatcatggcactcctgcggggcattgagcccaaggactatgagaaggtgttgcgg
gaggctggcgtctatgacttccgagcaatcctgaagcatctcaagatgatgcagaaggag
atggaaatcgaggaggagccagtctatgaggtgctggcagaaggagatgaaattgaagaa
gtggaagcgctgcaaatcgagtcgcccattttctcagttgcacctgccccaactgtcttg
agccgtgctgctgaaccacccaaagaggagtttctgtttgtggaggagctggaaccagtg
aatgtggcacccagtgagacagccgagctcatctgcacggtctccaatgaagcagccaaa
gtcaagtggttctgcggggatgaagaaatcctgatagatgatggcaaatacaagaccaaa
caagagcagaggaggcactccttgataatcactgatgtgaccacagaagatgctggaaag
tacttgtgtgcaatgggagataaaatcacttcaacgttgctcacagtaactgcagaaatg
cccgaaattttgaaggatctccagagtcagaaagctgatgaatcagaagatgttgagttc
acctgtgagcttactgacgacctcccggaggatgtcgatgtcacctggttcaaggcagac
accgagattgagcctagcgtcaagtatgagttgaagaaggacaagcgcaggttgtcactg
gttgtccatgacttgaagaaagaggaccaagctgcttacacagtggcaattggagaaaga
cgctcttcagcaactcttcaagtcaaagctttcactctcactccactgcaagacaccaaa
gcgaccgaatttgacaagactgccacgtttgaatgcacagtctccagtgagaaggctgtg
gtgacgtggctgaaggatggtgagaagattgaggctggtcccaagtacgagatccaagag
gatgggacgcaacgtgttctcatcgttcacaatatctcaccagaagacagagggaacttc
agctgtgttgtaggcgacgttgagtctgtagccgcactgagcgttgaagccaccaaaata
accaaaccactgagagaaactgagactacggaaaaagagacagtcaccctgacctgtgag
gtatcacatgagaagggtgttgtcaagtggcttaaagatggcaaagaccttccggacagt
ccacggtacaagaccaaggctgagggtaaggttcgatccctggtgatcgaggatgtacag
cgcgatgatgagggtgattacacctgtgtcgttggtgatgacaagactacggctggactc
tttgtcaagccaccaccagttgagttcctgaccgagctaacaccgatccaagtcacagag
aggcagacagcagagtttgtctgcgaggtctcggacgagaaagccgaggtaacctggctg
cgagacggcaaaccagttgagcccagcgacaagtacctgattgtcaagcaaggccgggaa
cgtcgcctctctgtcacaaacaccgagtttcctgatgaagctgactattcttgcgtcatt
ggggatcgaaaaacgacagctgagctcttggttgacgaagctgaaccggagatcgttgtg
tccatgcaagatgttaaagtgaccgaagatcaagaagcaacctttgtctgtgagcttgac
aaggacacgtccgatgttgtctggctgaagaatggcaaggagattgaggaagatgacaca
aagtttgaagtacagcgtaagggccgtcgacactcactgattgtcaaagacattggcttg
gatgatgctgccgcctacacatgcgtcgttggcaggaaagaaagttcagcgtcgctcatt
gtagaagagaaacccattgagttcactgagcccctccaaccgctccgagctagccccggt
gactcaacaaccttcgagtgcaccctcaacaaagacaacgtcgaggtggtgtggatgaga
aatgacaaagagattaagcccagtgatcactttgagatcaagaaggatggcaagcatcat
aagatgacagtcaaaggtgttcagtttgaagatgacgctgagtacactgtgaaagtgaag
ggggcagagtctaaatcatccctggttgtacaagctccaccaaagattgaaatagacact
gacaaactgacggtcaccatcaaagctggctccaagattgtcattgaggccactgtcatt
ggctcacccaaaccaactactacctggtccaaagacggcactgaactccatccagacaag
cgcatcaccatgacagctgacaacaccatgagggcaaaggtcaaactgaccattgacaaa
tcagagaggacggacctgggagagtacacaatcctcgcagccaatgatcttggttccgat
acggttattgtcaaagtcatagtccttgacaaacctcaacctccaaataatctccgaatc
actggaatcactcctacgactgtctcgctcatttgggagccccctgaggatgatggaggc
agcccagtcacggaatacatcattgagaagagagacatgaagcgtgctacgtggtccaag
gcaggaaccaccacctctgcagagctgggattcaccgtcatgaagctcttggaaggaaat
gagtacttgttccgtgttattgcagtgaacaagcacgggcagagtgagccacgagtactt
ggatcacctgttattgccaaacatcaatttgatgtgcctcatccaccggccaagccccaa
atctcagacattgacaagaccaagatgacgatcacctggtctcctcccgaatttgacgga
ggcagtgagattactggttacattctcgagaggcaggaagttggccgtgatcgttgggcc
aaagttcacaaggtcccattgaccgatacgatgttctcctgtactgatttgattgaagga
aaggagtatatattcagggtgatggctgaaaacaaagctggtttgagtaaaccgagcaag
ccatcagatactcacatggccaaaccaccctatgatgtcccaggggcacccagcaaacca
caaccagagaatattgatgttactacaatctccatcacatggaactcgcctgaatcagat
ggtggctcccctgtgactggatacatcattgaaagatgtgatgtcagccgtggtcgctgg
gtcagagccaatcgtgagaaggtgacagagctcacgttcaaagttacagatctggtggaa
ggtaacaagtaccaatttcgtgtctcggcagagaatctagcaggtgttggcacacctagt
gaaccatctgataccattgtggcaaaactgccttttgatgtcccaggagctccagagaaa
ccgactgtcagtgacattgacagcactaaaatgactgtcaactggtcacctccatcagct
gacggtggtagccctgtcactggttacatcttggaacgcaaggagaagacatcatctagg
tggacaaaagtgactagagaaccagtcacagagacagcactgactgtgaaagagctgatc
gaaggcaaggagtacgagttccacgtagctgctgtcaacaaggctggaagtggaccattc
agttctccatcagagccaagaacggccaagccaccttatgatgttccaggtgccccagaa
cggcctgctgttagtgacgttgacagccatcaaatgactgttacatgggaaaccccctct
gtcgacggtggcagcccaatcaccggctacatccttgaacgcaaggagaaaacttcctca
agatggatgagggtcaccaaagagaccgtcattgagaaaacactgaccatcaaagatcta
aatgaggggaaggagtatgagttccgtgtggccgccgttaacaaagccggaatgggtcca
ttcagtaagccatcagaacaacagaaggccaaaccaccttatgatgtgccaggccctcct
gagagacccacagttagtgatgttgacagcactaaaatgacagtagcatggacagcgcct
tctgttgatggtggtagtccagtcaccggcttcatcgtggaacgcaaagacacgacatcc
accagatggatgaaagtgaccaaggaaccgatctccgaaacaaaccttattgttaaagat
ctcatcgagggcaaggagtatgagtttcatgttgctgctgtcaacaaggctggaactggc
ccattcagtgctccgtcagaaccaagaatggctaagccaccctatgatgttcctggagca
ccagagaagcctgaagtgacagcagttgacagaacacagatcactatcacctggtcacct
ccagaatctgatggtggcagtcccatcacaggttacatcgttgagaagaaagaaacctct
tccacaagatggacaaaagctcagagagactcagtcacagaaacaacactgactgtgaaa
gatctgattgagggcaaggaatatgagttccatgtagctgctgtcaacaaggctggaacc
ggaccattcagtgctccatcggaaccaagaattactaaagctccttatgatgttccagga
gcaccagacaaacctgaggtgacagcagtggacagaacacagatcactatcacctggtta
cctccagaatctgatggtggcagtcccgtcacaggttacatcgttgagaagaaagagacc
tcttccacaagatggacaaaagctcaaagagaacctatcacggcgacactattgactgtg
aaagatctgattgagggcaaggagtttgagttccgtgtagctgcagtcaacaaggcagga
accggaccattcagtgcttcatcagaaccaagaatcacaaaacctccctatgatgttcct
ggagcaccagaaaggccccaagtgactgccgttgacagaacacagatcaccattacttgg
tcacctccagaatatgacggcggtagcccagtcacaggctatatcattgaaaagagagag
agaagctcaacaaggtggacaaaagctcaaagagactcagtcacagagacgacactgact
gtgaaagatctgattgagggcaaggaatatgagctccgtgtagctgctgtcaacaaagct
ggaacaggaccattcagtgctccctctgaaccaagaatcacaaaaccaccatatgatgtt
cctggagcaccagagaagcctgaagtgacagcagttgacagaacagaggtcaccatcacc
tggtcacctccagaatctgatggtggcaatcccatcacaggttacatcattgagaagaaa
gagacctcttccacaagatggacaaaacctaaaagagactcagtcacagaaacaacacta
actatgaaagatctgattgagggcaaggaatatgagtttcgtgtagctgctgtgaacaaa
gctggaaccggaccattcagtgctccatcagaaccaaggatcacgaaacctccgtatgat
gttccaggagcaccagagaggccagaagtgactgcagttgacagaacacagatcactatc
acctggtcacctccagaatctgatggtggcagtcccatcacaggttacatcgttgagaag
aaagagacctcttccacaagatggacaaaagctcaaagggaacctgtcacagcgaaaaca
ttgactgtgaaagatttgattgagggcaaggagtatgagttccatgtggccgcaatcaac
aaagctgggatgggcccattcagtaagccatcagaactacagaaggccaaaccaccttat
gatgtgccaggtcctcctgagagacccacagttagtgatgttgacagcactaaaatgaca
gtaacatggacagcaccttctattgatggaggtagtccagtaacttgctacattgtagaa
cgcaaagacacgacatccaccagatggatgaaagtgaccaaggaaccaatctccgaaaca
aaccttattgtcaaagatctcatcgagggcaaggagtatgagttccacgttgctgccgtg
aacaaggccggaaccggaccattcagtgctccatcagaaccaagaatagctaagccaccc
tatggtgttcctggagcaccagagaagcctgaagtgacagcagttgacagaacacagatc
actatcacctggtcaccttcagaatctgatggtggcagtcccatcacaggttacatagtt
gagaagaaagaaacctcttccacaagatggacaaaagctcagagagactcagtcacagaa
acaacactaactgtgaaagatctgattgagggcaaggaatatgagtttcgtgtagctgcc
gtgaacaaagctggaaccggaccattcagtgctccatcggaaccaagaatcactaaacca
ccttatgatgttccaggagcaccagagaagcctgaggtgacagcagtggacagaacacag
atcactatcacctggtcacctccagaatctgatggtggcagtcccatcacaggttacatc
gttgagaagaaagagacctcttccacaagatggacaaaagctcaaagagaacctatcacg
gcgaccacattgaatgtgaaagatctgattgagggcaaggagtttgagttccgtgtagct
gcagtcaacaaggcaggaaccggatcattcagtgctccatcagaaccaagaatcacaaaa
cctccctatgatgttcctggagcaccagagaagcctgaagtgacagcagttgacagaaca
cagatcaccatcacctggtcacctccagaatctgatggtggcagtcccatcataggttac
atcgttgagaagaaagagacctcttccacaagatggacaaaagctcagagagactcagtc
acagaaacaacactgactgtgaaagatctgattgagggcaaggaatatgagttccgtgta
gctgccatgaacaaagctggaaccggaccattcagtgctccatcagagccaagaatcact
aaaccaccatacgatactcctggagccccagggaagcctgaggtaacagcagtggacaga
acacagatcaccatctcctggtcacctccagagtctgacggtggtagcacagtcactggt
tacatcgtagagaagaaagagacctcttcaacaaggtggacgaaagttcagagagactca
atcagagaaacaacactgattgtgaaagatcttatcgagggcaaagactatgagtttcat
gtagctgccaccaacaaagctggaacaggaccattcagtgctccatcagaaccaagaaca
gctaaaccaccttataatgtgccaggacctccaggtaagcctgacgtcattgaaattgcc
aatacatccatgaccttgacctggacagctccagaatcagacggtggcagtcccatcact
ggatacatcattgagaggaaagaccgcttcagctcaaggtggctaaaggtcaaagagacc
tccatctcagagacagtgtacacagtaatagatcttaaggagggcacagagtatcagttt
agagtgtcagcagagaacaaagccggaattggcaagccaagcgaagcctctgacaagaca
gttgccaaaccaccatatgatgcccctggttctccaggtataccagagatatctgatgtt
gactgcacccacatgacactgacctggactccgccaaccgatgacggtggggctgacatc
ttgggctacatcatcgagaagtgtgatgctgacaggaaacgctgggtcaaagctcacaag
gaagacttgataactgacctgacattcaccgtgttagacttagtggaaggaactaactac
atgtttcgggttagcgctgagaatattgctggtattggtgagtccagcgaggcagctggt
ccccagaaagcaaaaccaccgtatgacgtaccagatgctccaaatagtcctgatgtttca
aacattgacaagacctctgtcctagtcacatggagtcctccggaacacgatggtggagca
gagatctctggttacattgttgagaggagagatgccggccgagaccgatgggtgaagact
cacaagacacccctgatggacaacagcttcactgctaccgatctgatcgaaggaaaagag
tatgaattcagagtcagtgcacagaacaaggctggcgtgggcgaacctagtgctccttct
attgctatcaaggcaaagttgccttatgatgtaccagatgctccgggcatccccaagatc
tctgacatcacagaatcctctatgaagctggactggacagtaccaaaatctgacggtggt
aaggacatcaccgattacttcattgagaagaaagaccgcttcagtccacgctggagcaag
gtgacccaggtaccatccactgacacctgttgtactgtggatgggttgaaggaaggcaat
gaataccagttcagagtgattgctctcaacaaggcgggtgctggcaaacccagtgattcc
tccaaaccaacagctgccaaatcaccatatgatgtccctggtgcccctagtgcaccattc
atctctgatgtaacagccacctccatgaccctgaactggactccaccccactctgatggt
ggcacccccatcactggttacaccattgaacgcaaggacaaattcagctctcggtggtcc
agaatcaccaaggagcctgtatcagagactactttcaaggtgtctggccttaaagaaggg
gatgagtaccagttccgagtgacagctgagaacattcgaggagctgggcagccgggtgat
gcttgttcctttgtgaaagccaagcctccttatgatattccaggcaaaccaccagctcct
aaagtcacagatattgacagcagtcaaatgacagtcacatggtcacctccagagtcagat
ggaggaagctccatcactggttacaccctggaaatgagagacacaagctccacacgttgg
gtgaaggcaatgcgggagagtatcacagaaacaacatttacagtgaaagacttgaaggag
ggtactgagtatgaattccgagtgacagctgagaacaaggctggggctggtaaaccaagc
gatgcatccaaggctcaagttgccaaatccaaatatgatgtaccaggtgctccagggaag
cctgttgtctctgatatcactgccgtttccatgacaatctcctggtctcctcctgactct
gatggaggcagcccagtcacaggctacatcctagagaagcgagatgtctctagcaaacgc
tggcttaaggtgtcttcggaaacaatcactgacttgagttttgacgtcactggtctgacc
caggggtcaagctacgagttcaggatcagtgcccagaacaaagcaggaacaggaaaacca
agtgttccctctgatgtgacagtggccaagccaccttacgatgtgccaggagctcccagt
aagcctgaaccctcaaatgtgacagaaacgaccatccacctcaagtggtctcctccaaag
tccgatggtggcagtcccatcatctcatacatcattgaacagcgtgagagctttgctaga
tcctggactcatgctctggagaccaagatgatccatgttgagtgcacagtcagctgcttg
aagcaggggactgagtaccagtttagagtcagtgctaagaacaaggctggcgttgggaat
ccaagtgaaccatcaaaccctattgttgccaaattgccatatgatgttccttcaccaccg
gagaatgtcaagctgtccattgtgtcaccaacatccatccagttgacatggagtattcca
tcaagtgatggcggttctccaattaccggctacttcatctataaaaaggatgctttttcc
cctagatggagtcagatcacctcagagctgattgaggaaaccacatacaaagtgaaagca
ctagaggagggctctgaggcattgttccacgttacggccatcaacaatgcaggcgagagc
aagccgagtgagactgttgctctcaagatccagcccccaggggctcccgatgctccaaag
attgaaaaaattgacaacaaatctgccgttgtgacgtggtcagctccggacaacactggc
ggcagtcccatcaccggttattaccttgagagacgagacactgccaaggatcgctgggtg
aaggtcaccaggggagccatcaaggagatgccatttgaagtcaaggatcttgtcaaggat
gcagagtatgagttccgagtgtcagctgagaacaaagcaggcatcggagaaccaagccag
ccatcaaagcgagctgtagccaagctgccttatgatctgcctggagctccaagcagacct
gaaattacaaccgttgacaagacggagataaccctcacgtggaaccctcctgaatctgac
ggcggtgcaccaatcactagatacatcttggagaagaaggaccaattctcctcccgttgg
tcagaagtcaacaaagtgaccaacactgaatacaaagtgaaaggactcaaagaagggtct
gaataccaattcagggtcagtgctgagaacaaagctggcgttggaaaaccaagtgagccg
agccaatccaaagttgctaaactgccatttgacgtgccagaatcacccaagaatctgaca
atctttgaccaaaaaccaacttcacttactctgagttggtcagctccagcgactgatggt
ggatctcctgtcactggctatgtcattgaaaggaaggacaaggttagcagccgttggaca
agagtcaacacttcctccattgaagaaaccagcttcagtgtcaccggactccaagaagga
accgagtatgagttcagggtgattgctgagaacaaagcgggcctaagtaagccctgtgac
tccgtggctttgaagatccaccccccaggggctcctgattctccaaagattgagaagatt
gacaacaaatcggccattgtggcatggtcagctcctgacagcactggcggtagtcccatc
actggttaccatctcgaaagacgagacactgccaaggatcgctgggtgaaggttactagg
gcagccatcaaggagatgacatttgaagtcaaggatcttgtgaaggatgcagaatatgag
ttccgagtgtcagctgagaacaaagcaggcatcggggaaccaagccagtcatcaaagaga
gctgtagccaagctgccttatgatgttcctggtgctcctagcaagcctgaaataacttca
gttgacaaaaccgaaatggcattgacttggactgtgccagagtccgatggcggttcacca
atcacaagatacatcttggagaagaaagaccaattctcctcccgttggtcagaagtcagc
aaagtgaccaacactgaattcaaagtgacaggactcaaggaggggtctgaataccagttt
agggtctgtgcagagaacaaagctggtgttgggaaaccaagtaaaccaagcgaaatcaaa
cttgccaaactgccttatgatgtcccaggtgctcctggaactcttgaggtctccgacatc
aagccaacatccctcagtctcacctggacacctccagaatgtgatggtggttccccagtc
accggctacgtcgtggagaagaaagacaagttcagttctcgctggacaaaagccaccatc
acctcagtacaagacaccacattcagtgtgctgggtcttcaagaaggcacggagtacgag
ttcagagtgagtgccgagaacaaagctggattgggcaaacccagcaatccagcctccttg
gagatttccccgcccagtgctccaggtaaaccagatgtgagtgaggtgaccgataaggca
gtcatggtcagctggagcatgcccaagtccgacggaggaagtaagatccttgggtacatc
gttgagaagtgtgacacctccagagaccgatgggtgagggtcagccggagccttttgaaa
gagactacactccaagttgaggagctgacggtgaaaactaagtaccaattcagagttact
gctgagaacaaagctggtagtggcccagccagcgaaccgtctgatattgtggaagccaaa
ctgccttacgaaatcccaatgtcaccggatagaccatcagtcagtgacatcacagccaac
tctatgaccctgtcttggagtgctcccacatctgacggaggcagtcccatcacgtcttat
gtcattgagaagaaagaaccttacggcaaatggacgcaggttgccaagaccgatggagat
tctcacaaagtggtgggactgaaaggaggtcagaagtacgagttcagggtggctgctgag
aacaaggctggacgagggagcttcagtgaggccacagctctcacagaggccaaggagcct
tatgtggtaccggatgccccaggcacaccagacatttctgacatcaagccatcttcacta
aaactgtcttggacagctcctgataatgatggtggatcacccatcattggctacctcatc
gagaagaaagacaagttcagctcccgctggaccaaagtcaacatttcctccatcatagag
aggaagttcaatgtcaccggactacaggaaggagaggagtatgagtttagagtcacagct
gagaacaaagcaggtctgggcaagcctagcaacccagccacccttaaagtcagccctccg
agtgccccaggcaaaccagaattgagtgatatcaccaacaaggctatcaccttgaagtgg
agcgtgcccgaatctgacggcggcagccgcattacaggttacttcattgagaagtgtgac
acgtcgaaggagagatgggtgaaaatcaacaggactgttgtcaaagagacgacattaaga
gtggaggaactgacggccaagacggagtaccagtttagagtcagtgctgagaacaaggcc
ggcactggacctgctggcgaaccctctgaagctgtgattgctaaacttccttatgacata
cccaagtcaccaaccacaccaaccatcagtgacatcacctccaagtccataaccctttct
tgggatgcacccagatcagacggaggaagtcccatcaccaattatgtcattgagaagagg
gaaccccttggcaagtggctccaagtagccaagacaccagacacgtcttacactgtcaag
ggtctaaagcaaggccttgagtatgagttcagagttgctgctgaaaataaagctggaatt
ggcagctttagtgaggcatctgatgcaacagttgccaaagagccttatgatgtgccagga
gtaccaggaactccagacatttcagatctgaagccaacatcactaactctgagctggaca
actcctaagagtgatggtggagctccaattaccaattacaccatcgagaagaaagataag
ttcagctctcgctggactaaggtcaacatcacctcagtcacgggtaccatcttcaatgtc
accggtctccaggaggggacagagtatgagttcagagtgacggccgagaacaaagctggt
cagggcaaaccaagcagtccagcttacttgaagatcacaagaccagatgctcccggtaaa
cctgaggtctctgacatcaccaacaaatctctcatcctaacctggtcagcacctgagtct
gacggaggtagtaagatccttggttacataattgagaagtcggacacttcaagagaccga
tgggtgcgagtaaacaggagccttgtgaaggagactacacaccgagtggaggacctgact
gctaagactgagtaccggttcagagtgagtgctgagaacaaggttggaactggacctaca
agtcaaccctctgatgctgttgtggctaaacttccatttgatacaccagcctcacctagc
aaaccaaccgtcagcaatgtcaccgcacattccatgaccctgtcgtggaaaccgccaaca
gatgatggaggggcaaagatcaagggttacatcatcgaaaagaaagaacccttcagtacc
aaatggtctcccgtcagcagtacagaagacacatccttcaccctgacaggattgaaggaa
gggacagagtatgagtttagggtggcagcagagaacaaggctggggtgggtgcattcagc
cctgctacggccccgacaatggcaaaggaaccatatgatgcaccagatgccccaggtact
cctgaaccaacagatgtcactgaacattccaccacattgacctggactcctccagcatct
gatggaggcagcaaagtccttggttatatcgttgagcgtaaagatgcctacagcaccagg
tggacgagagtcaccagagaccgagtcagtgaaaccacactgaaggtgacagacgtcaag
gagaattctgaatacacattcagagtgatcgctgaaaataaggcaggacctgggaaacct
agtgagccatgtgcacctgtcatcgccaaacgtccctatgatgttccaggtgccccagga
actccgtctgtctctgaaatcacagctaccagcatgactttgtcctggacccctcctgac
tcagacaatggttcacccatcacctcttacatcatagagaagaaggagaagttcagcact
cgctggagccgagtcaatccgctgtcggtcactgacacaacgtaccttgttaagaacctc
aaagagggtgatgagtatgagttccgggtgagcgctgagaacaaggctggagtcagcaaa
ccaagtcagtctgctggacctgtggttgctaaacctccatatgatgttcctgaggctcct
ggaaagcccaaagtcaccggcacaactgccaagacagccaatatcacctggtctgccccg
ccatcggatggaggcagtcccattaagaattacgtcatcgaaagaaaagacaggttctcc
acacgatggactgttgccaacagagatgaaatggtaaccgagaccagctatgttgtcaga
gacttgaaggagggtgaagaataccaattcagagtagctgcagagaacaaagcaggagtt
gggaaaccatctgaactgtcggagctaagagttatcaaaccagcatatgatgttcctgga
gctccagaggccccttccatctctgatgtcacaagcacaacaatgacactgacctggtct
cccccagaggaggatggtggcagcccagtcactggctacatcatcgagaaacgagatagg
ttcaccaccaagtggaccaaggtcaacaggtacacagtgatcgagacgagcttcaaggtg
agcgagttgagggagggcactgagtacgagttccgagtggcagctgagaacaaggctgga
gtgggcaagtttagcgagccgtctcagaagaaggttgccaagcaaccatacgatgttcct
ggcgtacctggtattccagatatctctgacatcatggccacagcactcaatctcacatgg
acagctccctctagcgacggtggcagcccaatcactacttacatcgttgagaggaaggag
cagtttgctagtcgctggagcaggatcaataaagaatcggtcactgaactcacctacaag
gtgactggcttgactgaaggcaatgagtatcagttccgagtgactgcagaaaacaaggcc
ggcccaggaaagcctagccagcctacagcaatggtcattgccaaacatccttacggagtc
ccatctgctccaagcactccaacactctccaatgtcaccagcacctcgatgaccctgact
tggtctccgcccgagtttgacaatggtagccctatcactggctacgtcattgagaaacgc
gatcgcatgagcacccgctggacaagagtaaacagggagactgttacagagactgcttac
aatgtgactggcctgattgaaggatcagagtatgagtttagagtcagtgcggagaacaag
gcaggaattggagaaccaagccaaccatcgaggtcaaccattgccaaacctccttatgac
aaaccggatgcaccaggccagcctaccatctccaacatcactgcctcctctatgacattg
acttggactccacccacattggacggaggtagtcccatcaccggttatgtcattgagaag
aaagaccgcttcagtactcgctggtcacgagtcaatgactacagcattcaagacgtcgaa
tacattgtgagtggtctgaagaagggcactgagtatgagttccgagtagctgctgagaac
aaagcaggagttgggaagcccagtgagtcgactggctacaaagttgctaaaccaccatac
gatgtggctaacacacctggcaccccagagatcactaacatcaagccaacctcggttacc
ctcaattggtcccctcctgactcggacggtggctccaacatccttggctacatcatcgag
aagaaagacaagttctcaccccgctggacccgcgtcaacacctccttggttgaagacacc
agcttcactgtcaagggactgtccgagggacaggagtgcgatttcagaatcatcgccgag
aaccaagctggttcaagtaaacctagcaatgtgtccacctatcacatccagccgcccgat
gctcccagtggtccggatgtctccaacatccaggagaactcagtcacgcttacctggtct
ccaccacaggctgatggtggcagcaaaattaccggttactatgtggagaggagggatgtt
gccaaagaccgctgggtgcgagtcaacagaatgcctgtgaaggagactaggctggttgtc
cctgacttgatgacaaatgctgagtatgagtttagagtgattgctgagaacaaggctgga
cttggaaaaccaagtgagcctactcagcagatcttggttaaaccaccctatgacatccct
gaacctcctagcactcctgaggtgtcagacatcaccaagacatctgcctcggtgtcatgg
caaccacccatatcagacggaggtagcaagatcacaggctacgtggtggaaatgaaggag
cagtactccacccgatggaccgcggcagccaaacctcgggacacagagtgcaagatcacc
aaactgagtcctggcagggagtatgagttcagagtgagagctgagaataaggcaggactc
agtgagccaagcaggccatctgcaagctttgttgccaaggacgcttatgatgttcctgat
gcacccagccgaccaacaacaagtaacatccaggagcactctgtcatgttgtcatggtca
ccaccagcatccgacgggggagccaagatctcgggctacatcattgagatgaaggaggaa
ttcactagcagatggactcagataaacagagagcgtatcactgacacagaattcactgca
accaagctaaaagagggagctcagtacgcgttccgagtgagtgccgagaacaaggctggc
gtaggcaaacccagcgagccatcagcaacagtcactcccaagaaaccatatggtgtgcca
gatgcccctggcaaaccaaaagtgaccagctcaacatccagctctgcttctatcacatgg
tcacctccatcatccaacggtggtagccccatcacaggtcacatcatcgagaaacgggaa
gacggaatgggcccctggaccaaatgcagccggtacgagatcaccgagacatccttcacc
gtgagagacttgatggaagggagtgagtatgagttcagggtgagcgctgtcaacaaggct
ggcgttggcaaacctagtgcaccgtcggatagtgtgactaccaaaccattgtacgttgct
cccaatgcaccaagcattcctgaagtgactgattcaacatctcgctccgtcagtctctcc
tggagcaaacccaaagacgacggcggtgatcaaatcaccaattacatcatcgagaagaaa
gaaccattcagcatccgttggacggaggtcggtcgtactccggataccagcttcaccgtc
aacggtctcaaggaaggggaggagctacagtttagagtgacggctgagaacaaggccgga
cctggcaaaccgagccaagacactggtaaagtcatcgtgaaaccaccctatgatgttccg
gatgcgcctgggaagccaacagcctccgatatcaactcaacctccatgacagtcaattgg
actgtgcccaaatcagacggaggcagtcgtatcatcacctacatcatcgagatcaaggag
caattctccacctactggaagcgagtcaatccccaggaggtgacatcaacttccttcaag
gtgtcatccctgaaggagggtggcagctatgagttcagagtgagtgctgagaacaaggca
ggggtcggcaaaccaagcacggtgtcagagacgttcattgccaagctaccatacgatgtg
ccaagccagcctggtgctccagacatctccaacatccaacccacttccatgaccctgtca
tggactgcaccaacttctgatggaggtagtccactcacaggctacatcatcgagaggtgt
gacacaagcagtagtcgctgggtccgcgtcaataagtacacggttaaggacttgagttac
actgtgactgacctgagggaaggctgcgagtacaagtacagggtgagcgctgagaatgct
gcaggcatcagcaaacccagtgaggaatcaacggcaaaggttgccaaacatccttatgat
gtccctggtgctccatcaagaccacagatatcacacatcgataccaccaagatgactgtt
agctggtcccctccagactccgatggcggcagtccaatcaccaactacatcctggagcgt
aaggataagttctctactcgttggatgcgagtgactcgtgacaggatctcagagactgag
tttaccgtgcagggtttgatggaggggactgcgtatgagttccgagtttctggtgagaac
aaggcaggaaccggacctgctagtgagccttcggagagcaaagtggccaagactccttat
gatgtccctgatacaccaggcactccggatgtatctgatgtcacatcctcatcaatggtt
ctcacatgggcagagccattctcagacgggggcagtcccatcaccaactacatcattgag
aagcgcgatcgctacacttcccgctggactcgcgtcaacaagtacaacatcacagaaaca
accttcactgtgactgatctgaaggaaggttcagagtacgagttccgtgtctcagctgag
aacagagcaggtgttggtaaaccaagtgagccatccagtttggtcaaggcaaagccgcct
tatgaatccccgtcatcaccagctgctccttacatctcagacatcacggccgattctatg
accctctcctggtcacctcctaagactgacggaggcagtcccatcactggctactacgtc
gagaagaaggatcgctttggcctacgctggacaagagtcaaccgcgaacctacccaggat
actacattgaggataccgggactgtctgagggtgaggagtaccagttcagggtggttgcc
gagaatagaggaggtgaagggaagccttgcgagccaacagaaccaacagttgccaaggca
ccatacgatgttcctggtgcacccagcgctcctcagatcaccaaggtcactgagtccacc
atgagcctgcactgggctgaacctctctttgacggaggcactcccatcctgggctaccac
attgagaggaaggacgccatgggcagacactggactcgcatcacccgcgaacctgtcaac
gatgtcacctacaaggctactggattgatggagggttctgagtacgagttccgggtattt
gctgttaacaaggctggagtcggtagtccaagtaatgtttcagatgtcgccaaagcaaaa
ccaccttatgatgtacctggtgctccaggaatgccagtcatctcagacaccacctcttcc
tccatgcacctctcctggtctgagccggaatcagatggaggcagtccaatcaccggctac
ctcattgaaaagagagagcggttcagcactctctggacgccggtgaccaagcgagaagta
cccgaggcatcctacacagtgactggtctgacagagggaatcgagtatgagttccgagta
gccggtcagaacaaggcaggggccgggaagtttagtgagccaacaagacccactgttgcc
aaaccaccctacaatgttcctggctctcctagttcccctgaagtcacagacattacaccc
aactcaatgactcttcactggtccccaccagcatccgatggcggcagccccatcacaggc
tacatcgtggagcgtaaggacaccagcaagatgggttggacggtggccaatagggtaccc
atctcagacacgtctttcactgtgcccaacctgagagaaggaacagagtacgaattcagg
gtcattgctgagaacaaggcaggaactggcaaaccgggcgttgcctcacaaccaaaactt
gccaaggctccatatgatgtgccagatgctccaggcacaccacagatctccaacatcacc
gcgacctcaatgaccctcgcctggtctccgcccaagtctgacaacggcagtccagtcacc
aactacatcctggaaatgagacaagacttttccatgcgctggaccaagatcagtgcgtct
gttttggagacaacccacactgtgactcggctgaccgagggcagcaagtatgtcttcagg
gtagctgcagagaacaaagctggccctggtcagttcagtgagccatctgaccaagccata
gccaaaccaccatacgatgcaccaggatcaccagacacacctacggtctctgaagtcact
gcaaatactgcccttttgagttggtctccacccagcgatgatggtggtgctgccctcaca
ggttacgtcattgaaaagaaggataagttctcaacgcgttggactaaagtggatgaggtg
aatgcagatgcaacctcattcaatgtacgtggcctatctgaggggaacgattatgaattc
cgcattagtgctacaaacaaggctggagttggcaaaccaagcgactcatccaaccgattc
acagctaaggctccatatgatgttcccgatgcaccaagtgccccgacaatcctagaatcc
acaaactcgtccatgactctatcttgggcaccacccgtcagtgacggcggtagccccatc
accggttacatcattgagagacacgatcttagcaccagtcgctggattaaggcgcacagg
gaaccattgacagatacgacatacactgtgcgagatctgacagcagataagaagtacgag
ttccgagtcagtgctgagaataaggcaggcgttggaagaacaagtgagccatcagctgcc
cgagtggctagacctccatatgatgtgccagatgcccctggcaaaccacagataaccaag
acagacagcacagaaatgactatcacctgggccccaccagcctcagacggtggcagcaag
atcatcagctacatcatcgagaagagagatcgtttcagcactcgctggcagaagatcaac
cgttactcagtcactgataccactttccaagccacgggactgagtttcaagatggagtat
gagttcagagtgagcgctgagaaccaggcaggtgttggcaagcctagtgagccatctgat
gctgctattgctaagcctccttatgatgtgcctgattctcctgagaatgtcaacgtcaga
gaaacaacttccaactctgcctccctgacctggagcccgcctcactcagacggtggagca
cccatcacaggctacatcatcgagaagaaagaccaatacagctcccgctggactagagtt
aaccgcatcccaatcctagagaccgagatgacagtgcctgacttgaaggaaggatttgag
tatgagtttagggtcagtgccgagaacaaggctggcgtgggacggataagtgagccatct
agacctacagtgataaaaccaccatttaaaataccaggtacaccttctgccccaacaatc
tccgacatcactagtacatccatgaccctctcttggtcacctccatcttccgatggtggc
agtccaatcacaggctatactgttgagaagcaagagcccttcagcactcgttggacacct
gttgagacattcactggcacctcaggaactgtcggaggtcttcgtgaggggaccgagtac
cagttccgagttgtcgctgtcaataaggcaggcaacagcaaacctagcatgtccagtcag
ccaagagtggctaaacctccatatgatgtaccaggccctcctagtactccgtccatcaat
gaaacaacagcaacttcgatgacactcgagtggtccccacctctctccgatggtggttcc
aagatcatcggctacgtcatccaaaagaaggaaaaactcgccctgcgatgggtacctgtg
aatcaactgagcatagcagagacgacatacactgtcagggatctagtggagaagtcggag
taccagtttaggatcttggctgagaacaaggctgggtttggtccaccaagtgactcatcc
gagaccaagatggcaaaaccagcttatgatgttcctggccagcctgaagccccaactgtc
tctgacactaccaagtcaaccatcagactcacctggtcccctccattgtcagatggagga
agcaagatcaccggctacatcctcgagaagagagagcccttcggcttcaagtatacccga
gtgaccacccgctcaatccaggagactgagtacacactcaccaacctgagggagggtagt
cagtacgagttccgagtgagtgctgagaacaaagctggagttggtacaccgagcgagcct
tgcagaccagtcgtggccaaggctccatttgacactccaagtgcaccaggagttcctgaa
atctcagacgtgactggcacctccctgactctctcctggactccaccagcccacgatgga
ggcaatcccattaccggttacaccatcgaacgagcagatcgttacagcacacgctggtcc
cctatcaccaaggaaccagtgagggactgcagctacgtggtcagggatattcccaaggga
gcgatgtatcagtaccgagtggttgccgtcaacgacgccgggatgggtaaaccaagtgac
gctactgacgccaaaggacctgcagttgcaccgaaacttgacctgaacaagtatcgtgac
acactggtggtcagagccggcaccaccttccatctggatgtcccctacaaagcccaaccc
agaccagtggtcaagtgggacaaggacggcatcccgctggtgtcatcaacccgagtcaag
attgagaccagtgatcgcgagacggtcttgacagccaagaactgtgtcaaggcagatgag
ggtgcttacaagctgagcgtcagcaactcagcgggaagcgagaatgcaattattcatgtc
caggttcttgatcgtccaagcccaccccaaggtcctcttgagattctggacatggacagc
acctttgtcaccctgtcctggcacccgccgtcagacgacggtggaagccgtgtcacccat
tacgccatcgagaagcgtgacatgaagaggacgtcatggtctcgtctgccagtccatgtc
agtaacaccacccacagagtgcagaacttgatggaaaaggcagagtatggcttcagggtg
atcgccatcaataagattggggagagtgaaccgttagaaggaactgaaaagatcttgatg
aagagcaaatatgaagtccctggtgcacctagcacccctcaggtcaccgacaccacagca
gattcagtcagtctgtcctggctacccccgtcattcactggcggggctgaaataatcggc
tacgtcatcgagaagaaggaccgcaccagcatctactggagcaaagtggccaagttggat
ggagatgaaacatcctgcattatcaccagactcacccgcggtggagagtatcagttcagg
attttggctgagaatcgtgtgggtgtgggagctcccagcgagccctccatcagagtcaag
gcagaagaggcagcagttacccctaaacttggagaagtcaaagagcccatcacggccaag
gttggtacaaccgtgagagtagaggtaccatacaccggcttccctgtgcctcgcacaacc
tggactagagagggtgcatcactgccatcgtcgcagcgcatgaaggtagagacaactgat
cgcgcagtcgccatgatcatcaagaactgcgagaggtccgatgcagggaattacacggtg
acagtcaaaaacgacgccggtagtgactccaccaagattgaaatcaagatcttcgacaag
cccagtccccctcgtggacccttagagcaaaccgacgtgaccgagaatgcagtcacccta
tcgtggcgacctcctcaagatgatggaggcagtcgcatcttcaactacatcgtggagaag
caaggagagtctgactacaagtggaaaccagtaacagagaaaaacatcacggacttgacc
taccgagtgactggcttgaaggagtacaagagataccagtttagagtgatggctgttaat
cagtttggtaccagtgagccattggagggacaggcagtgatgcccaagggacaatacaat
gttcctgatgcccctgacgctcctgatgtctccaacatcaccgtcgattccatgaccttg
tcctggagtccacctctacacgacggtggagcaccggttactggctatgtggtagagatg
aggcagactaccagtccacgctgggttaaggcaacgctcacacctatccctgacactaca
ttcaaagttagtcggttgttgagaggcagtgagtacgagttccgagtttctgctgtcaac
cgagctggaactggtaacccgagtgagccgtcacagagcgtcatcgctgaaaatcctcca
gtacctcccaaactggacctagatctcaagtaccaacgtgtgatcactgtccgtgctggc
acctccttccgtgttgaggtcccctacaagggcacgccggtacccaccatcaaatggatg
cacaactctttatcacaggttagtcggttgttgagaggcagtgagtacgagttccgagtt
tctgctgtcaaccgagctggaactggtaacccgagtgagccgtcacagagcgtcatcgct
gaaaatccaccagtacctcccaaactgaacctagatctcaagtaccaacgtgtgatcact
gtccgtgctggcacctccttccgtgttgaggtcccctacaagggcacgccggtacccacc
atcaaatggatgcacaactctgtccccatcgagcgtaccctacgcgtcagcatagagacc
aatgactttggcaccgtcctgaacacaaggaactcggagagggaagacagcggtgattat
gttatcacggctaccaacaaggctggtgaagcatcagcgactctaacagtcaaggtgttt
gatagaccagggcctccagaaggacctttacaagttgtccgtcttggcagcaatgacgtc
actctctcctggagcccaccctcagacgacggaggcagtcagattgtcggttacatcttg
gagaagcgtgagggcagtatgcgcatgtggagcaaagtatcagcagcgctgacggaatgc
atgcaccgagtcatcggcctcactgaggggaatgagtaccaattccgagtccgagctgag
aacaagtccggtgtgagtgagcccctagaaggagaaaaggtcattcctaaaggggactat
gaggtaccaggcaagccgggaccagtctccatctccagtatccatggcgatgctgtctcc
ctcaattggtcacccccatccaaggatggaggggccccaattagcggttacatcattgag
aaacgagacagggctagtgacgcctggagcagagtcaacgcggctcccataacagacagc
agttacaaggtgccaaggctcatccaggggactgaatatgacttccgtgtcagtgctgtg
aataaggcaggagtcggggaaccagcagctactccaggaccagttctggtggagagacct
gccgccgctccaaagcttgagcctggcgctgtgtatcgtgacatcatcaaagtccgtgct
ggatccaacctacacatggacatcccctgccgaggcaaacccacccctaccatctcctgg
accaaggatggctcagagattgcgatagatgccatcagagtccgggcatccaccaatgac
tttgccactaatctgactgtcaagaacaccggaaaggctgacgcaggtacctacgttgtc
agagcaacaaacaaagccggttcagacagtgctaccatcaaagtggtggtgttggacaag
cccggcccaccagagggtcccttgaatacctctgacatcaccaaggattccgtcacgctg
tcatggcaaccaccaaccgacgatggaggcagccaggtcaccaactacatcctagagaag
cgcgaggcggaccgactgacgtggacccgcgtgtctgccaccatcaggggaacgcgctac
acggtgaccagtctgattgatggcaccaagtacatgttcagagtgcgagctgagaacaag
tacggacagagcgaaccactgaatagcaccgatgcagtgctcgtcaagagcccgtttgat
gttcctgatgcacctggtacccctgaagtctcaggcatcaccgacaccaccatgacagtc
tcctggaaaccacctcgcagcgatggaggctcagagatcaccggctacatactggaaatg
aaggaaaccacgggcgtccgttggatgagagccaccaggaaggtcttgaaggagtctaac
ttcacggtgacaaatctggtcaaggggagagagtacgagttccaggtggccgccgagaat
gaggcgggggttggacccatgagcagaaaatctacttcagcttgtgccaagacacctgtc
gaaactgcagagttcactgagcctctgacagacatctcagccaaggtaggcaagacggtc
accctggagtgccgtatctccaatgccaaggctgaagtcaagtggctcaaggacggagtg
cagatctttgccgtggacagacacagcatcatcaaggaaggccaaaggagagcgttggtg
atccgagacgttggacctcgagacattgggaagtacacatgtaaatgtggggatgcaagc
accgaggccacagtcaaggtcaaagctgaaccaaagattgacctctctgactacaaagat
gtcatcactgtccgtgctggtaacgtccttcgtctctacgtacccttcaccggatgcccc
acgccaacagccgagtggtatcgtcatgaccgccgcatcagcgaagacagcagaaccaag
atagagaaacaggagaacagaacagaattggtcatcaagaacaccatccgatcagacaca
gggcaatactcactgactgtcagcaatgaagctggcaaacacacagctaacatccatgtc
atagtggttgatgttcctggtccccccaccggacccctggagatctccgacgtcggccgt
ttctctgtcaacctctcctggtccccgcccagagaagacggcggctccaagattgaatac
tacactgtggagagacgggagaagggtcgcaagctgtggacagtagctaccacgtatgct
acaacaacatccttcacagtgacgggacttggtgagaacatggagtatgagttccgagtg
agcgctgagaacatcaacggagttggacctcctctggaatcatctcaggctgtcgtctgc
aagacgcccttctctgtgccgagcgcgccaggcaaacctgaagtccataacatctgccat
gatcacatgaccctgacttggaccgagccccagcatgacggcggcaagcccatcacaggc
tacatcctggaaatgagagagaactttggcgcacactggaagcgagtcaaccgcgaatca
gtggtggacaccacctacacagtgaagggattagtggaaggtcaccagtatgacttcaga
gtgaccgctgagaatactgtcgggccaggcaagcctagccaaccaactcacccaccacgc
attgccaaggaccctgcaagacgaccttcaccacctggttgcccaaccatcaaagacatc
acatcaacgtctgtgaagctcagctggaccgttccattctcagatgggggccagcctatc
acccactacacggtggagcgtagacggaagggctcttacgactggacagacaagctgacc
acccctaccaactcttgtcaggtggagaagctgtcacccaacgtggagtacgtcttcagg
gtgtgtgcggtcaacactgctggcatggagagtgatcctagcaaggcttcagaggcattc
gttaccagagagtcactccctggagtaccaccaactttcacagaggagccacacagcacg
atggttgctgagaaaacaaaggccgaattcacctgcagagtggccgggacacccacgcct
catgtggactggatccgtaagggtagggagttgttcaccggtcgcaagtacagcataaca
acagacaaagatggcctacacagactgaccatccatgaggccagagagctggacagtggc
atgtacacagcagttgcccagaatgagaatggaaaggttcgcgcatcggcagaactccac
atcaaatcgctgccaactctggaccttgaccgccgcatgagagacttcagtgtccgtgct
ggaagcaccctgcgcatctccatccctttcactggcacacccacgcccatcctgaggtgg
aagaaggaagacggtgaagagattaacacaagaggacgattccgcatcgatgccttggga
ggtgaggccgatttgaccatcagggagacggagagagaagacagcggtgtctacatctta
gaagctgagaacgagtatggagtgcagcaggtggcagccaaagtacaagttgttgacaaa
cctggaccgccaactggccccatccagacagtggaggtcagcaagaaatctatcacgttg
tcgtggcaaccaccagctgataatggaggaagtcccatcatacgctacattgttgagatg
aaagaggctaacagaactatttggcagaacgtaggctttgtctctgcatccactgagcac
acagtcagtggactcatggaaggaacggcttatctcttccgagtctctgccgaaaatcag
tatggccccagcgaacctctgattggacgagagtcagtcatggccaaggctccttatgat
gtccccggtgccccagggaaaccatcggtgtccgacatccaacgccactccgtccatctc
ctctgggttccaccagaatcagacggaggcagcccaatcaccaactacattatcgagaag
caagagacaacgagcacccgatggttccgtgccaacagggaggaggtgacaggaaacagt
cacaccatcaccaacctcattgaagactccgagtatgaattccgtgtgattgctgagaat
aaagtcggcttcagtcaaccgagtccatcttctcagcgagtgatagtcaaggacccaaga
gggtctatcccagcttcgtttgtccgtactccacaatccattgccgtcacccaaggcaga
gcaggaaccttggagtgcgaggtagccggctacccgtctcctcaagtcttctggtaccgt
ctcggccgcgaacttcacgacagcaggaagtacaagatcagagccagcggcaacatccac
acactgcagatcaacgatgtctatgaggaagatactggagagatcacagtcaaggtcatg
aacaaagctggatcacagactgagaaagctgacctccagattcaagttgctcctaaagtc
aacgtaccaccacgcctccgcatcccccttgattgtctccaaggagagatcttgaaactc
agaataccttacacaggcatccctgcacccagcatcacctgggaccatgacggagttgac
atcaagcctgccaggaatctggagatcaagaccagcgacaaggagacaatgctgtccatc
actacagttagcaaggaggatgcagggaaatacacagtggtcgctacaaatgagctggga
tacgattcagcaagcattgtcatcaacatcctgagacaaccagatccacctcgtaacttg
gaagtcctcgacgtcacctcggataccgtccgtctctcctggcaaccgcctctccatgac
ggaggaagcaccatcaccagctacgtggtggagaaacgagatgctggatccaatacctgg
gtccgctgcgttaccagcagaaactgcttccataccatcgtgggcttgaggtctgagtca
gagtaccagttcagagtcacagcattgaactccttcggcgcgagcgagccgtgtgaagca
tcaactgtcatagcaactaaaccttcggcattgacccgcccagagcttgaagattatgaa
gccaagcgacgattctatgattcactggttgatttgagctggattccgtccaggtttgac
tacatcaagcgatttggctctgtctatgactactataacatctatgaagaacttggaaga
ggatcctatggtgtggtctacagagctgtggagaagaagacaggcaaaaccttcgctgcc
aagttcctacgctgccagggtcacgagagagaagttgtcaaacgagaaatcgatatcatg
aagcgactgcatcacccagcattgctgtctctccatgaggtgtttgagaacgacgaagaa
ataatcatgattatagaattcttgtctggcggggagttgtttgatcgtctcgttgacgaa
agccacatcttgactgagcccgaggttgtcgactacatgaagcagatctgtgaaggcatc
agacacatgcacgagaagcacatccttcatcttgatctcaagccggagaacatcatgcta
cgtactcgcactggcaacgatgtgaaactcattgactttggtctagccagggaactcgac
ccacatgaacaagtgcgcgtcatgtttggcactccagagtttgtggcaccagaagtcgtg
aactttgaacccattggactgccatccgacatgtggtcactcggagtgctggcatacgtc
atgttgagtggcatctcgccattcatgggagaatccgacattgacaccttgaagggcgtg
agtcggggggaatgggacttcgacgaggaagcatttgctgatgtgtccgatgaaggactg
gattggattgagaagattctaattcaggacaaggacaaacggatgacaatccaagaagca
cttgcccacccgtggctcaacatggagactgatacccttgctcggagacgcgctcgacga
ctcaacaccaggcgtctcagaaaactacacgagaaacgcaaaccagagggggctggcgaa
accatcaacgccctcggccgtcttgctcatgggggcgctcttcgagagatacacaaggtc
taccgtggcatgccactacatgaaaggctcgtctatatggatgtccgtgatgccgctccc
aagtttgtagttcctctcgagacgaccaccgccattgagggtaatgccgctcgcttcgag
tgtgaagtctctgccctcactgaacccctcatcacctggtacaaggggaagactccccta
cagataggaatcaagtacaagatgctgtacgatgatcgcaagtacacgctggtcgttcag
gacaccaatattgatgatgtaggggagtacacctgtaaggcagtcaactcgtacgggtca
gcaacatcatcggcgtctctggacattgaactgcttgatgaagaggagttggagagacgt
ggagaaagacggactctggaaatgaagagacaaaaaatccctctgggagaacgagctcgt
cgtctgcgtgccatgcaggccgagatgggagctgaccaaccaccacagtttgtcaagact
ttgcaagacaaggaatgcggtctcggattcattctaccactctcgtttgaagtaactgtt
ccaccagagcccaccaaggtcatctggtacctcaatggcaagcaactcaaggaaggaccg
cgctacaagttctacgtggataatggcacctacacgctagaggttcaggagaccacgctg
gatgacatgggtgaatactgcgccgaagtgaccaatcaaacagggacgtcagttacaaag
tgccaagtagccgtggatgaaaacttcatggacaagtatgctggatatgtcagaccacat
tttgttcagcgccttcgagacattctcattgttgaggggagtgcagcaagactggaatgt
aaggtcaatggcatgccggatccagatatcagatggttcaaggaccacaaagagattgag
gatggtgtccactactctatggagtttgaggatgatgatacatgcgccctcatcctacag
gatgtgttcttgactgatgctgggacctacacttgccaagcgtctaacctccttggtcgc
atctcctgcgactcacgtgtcaaagttgaacgttgtggagcagagagcgaaccagcctca
gaaccatcacgagagtcaagtcttgaagatctcacgacaatctccaaacacatacccgcc
cgccgccgtctgaactgtgctccattcttcagtctgccactccgtcgcaagaaagttgca
gagaacgacagtgtccgccttacttgcgctgtgcagggctaccctgctcctaaagtagca
tggacaaaggatgggaacccaatattcgatggctactactacagcatcaccaacaggtgg
ggtgtatgttcattggaggtgcatagtgccagactgagtgatacaggaacctaccgatgc
acggctaccagcgaagagggtcaggatagctcggcctgcgagttggttgtggaagaaaga
atggaaccagatgaaaccctggactacatccgtccatccttccacaaacctgtaagaggc
aaacgcgttaaggaaggaaagacagctcatcttgacatacaagtttctggattcccagag
ccacaaattatctggtacaaagacaatgtccgcattgatgaggacgagcacatttctatt
gagaaacatcccgggggagctcagaccctggttatcactggagtgacaccaacagatgct
ggacgatacaaggctgcagccagttcacctgctggcaaggcttcttgtgctgcagacctt
atcgttctggaagttgaagctgatgtggaatctgaagatgagggtgaattgggacgaggc
agaggaagacgccggactcgtcgtaaacccaaggaagagcccaaagagcctaaaccgcac
cgcaaaccacaaaaggtgcgtccagtcccagagactttcgaggagcgaaaggcaagaaga
atccaacaaaggaaggaacagcctcttctctaccggccatcatctgtacccgtgagaagt
cacagacgatcctacagtccttcctacatgccagcatttggacctcctcctttgtacagt
ccaaccattgatatgagaaagcagaagcctgtaccaggatacaaaccagtaccctatgcc
agaaccccaccactggctcgtgctcagtcagtacctgtacctgttgtcgcacgcaccatc
ccgcatcctgttgttgatgatgggtatggaccgacttacatccctcattatgagatccca
aagaagggcagacatggagagcacaaatgtccaacaccatcctacgtgcctcatcatgca
ctccctgctaaagcagtcacaccaacgccccatgacgaccgctactttgctgccctgttt
gaggatatcctgagcgcctcagagtatgagtttcaacagagagagaggacaccatctttc
ccaaggtccagaacaccgagtgtatcgaggacaaggagcataacaccaacacgaagacga
agaaccttgtcatctgactatgaagatctatacggaagacggccaagctatgaagggaag
agaactcgaagtattacaccaaccagagccgggtatataacaccgtctgcccctgattat
gatgcttacatgaaaaaaatgaaagccatacagaagcagcctcaagctttcagaccaagt
tctgtccctgcgagacaactgccagagatatttacaccagtgtttgatgatgaggaaaga
attcgtccagtgcccaagaggtatcctcaacctgtcagagctaaatctgttcctccaaag
gaaggccggcctgtcaagaaaacagatattgagcgttatcaccttccatctttgcgggag
ttcattggtaataggccgcatcctttcatgccaagagagaagtctgtcactacagcacca
acacctagcagaatgtcaagcacctctgaattcgaagatcactctgtgccacatgagaga
aggcctcgatatgactcccagagttctacaagctcctacagaggtagatcaacaactcca
acagctaggtatggtgggaggagtgtaactccagcatctgattatggagacaaagactac
cgtcgtacctcactggacagaccaactcctcagagcttcaggcagaggtccaaatcacca
agtatgtcaactgtcccaaagcgaagtcgcactccaacaacacccgagtatgagagatca
tttgactccttcagaccaagatccatttcgccgagagctgcagtggtcttagagagaggt
gctaagccaccatcatcggtacacaagcattcttacgatgccgctcagagacgagacatg
acaccaactttctctgacacacagcacaggccaagggacatgagactactgtcaaccgat
tcagttgaatcctttgactcaagatctcgttccccaggtctaagacgctctgtgacaccc
gttggaactgactctgaacgcacaccacgggagatcatgatcattgagagaatgtcatcc
tatgattccaccagtggaagatctatctcaccaactcctgaaaagagacacagagaattc
ccgaaatcatccgtgaagaagtcctctgcttcacccacagtctctgctcccagacgtgac
agtactccaacctacccagattatcggcgtagagaatattccttgtcgtcttcagacata
gaatcctttgaagcacctagactaaggcctgcatcacctagagttactccacatcacaga
caaagtaccaagccatccgatgatgcagaacagcagcagagagattaccagttgctgtca
actgactctattgagtcatacagtggacgatccccatcacctcttcatggccgtccagtc
acaccagttggcaccgattctttgcgcactccaagagagatccgcattattgaaaggttg
tcatcctacgattcagtgaggcagagtggcatatcaccggttcctggcacccgacgcagt
gtaactccatctcaggagcaactgcagagagatgccaggagaccagtctctccaaggatg
ccttcttcatctgcagtttattctgatcagaagaggagtatgacatcatcagagcaatat
catagggattaccccataccttcagacagaaaatctgttgagacacgtgcaagaagacct
gcctcaccagaggtgacaagacaccacagacgaagtgttacaccaacatcatctgacact
gagcgcaggcacagagactcccgattgttgtcaacagactcacatgaatcatacagtggt
cggcctacatcacctcattctggaagacccgtcactccagttgctactgattcactacgt
actgccagagaaatcaagatcattagcaagttgtcatcttacgatacaccaagagagagt
gccatgtcaccagttttgggcacaaggcgaagtgtgacaccaacttaccagcgacggcca
agtgatgtgaagagacctgttactcccaagacctatgcttctgcccaggaatcaagcaca
ccctcagctccaaggggtaccttggcatcaatgtctgatgttaccacaagaaaatcttac
acatctcctcgacctgcctctcccagagatgtctcacaccgagattctcggcgagagcgc
gccagttacaggcagctgttatcagagggtgaatcttctgagacccagcttacacctcag
ccaacatcattactcccagagcgtccagttactccggttgctacacagtctctacgtaca
gcaagagaaatccgcattgtggataggatatccacaagagacagaacgacttcaccaact
acacgatccaagcaaagggattacagcttgccatcaagtcagagcacatcagcctattcg
aagcctgaacgtagagattaccagtcttcttcatatgcctcatcaaccagatcttatgat
agatttgaacctcagcatttgtacagacagagatcatcgtccccagtgaaacgctcagtc
tcaccaatctctttgggtgttcaggaaagggatttgtattcatcatctagcaagaagtca
taccgtgatagctacgagtcgagtcgtagccaccgacaaagatcaccatcacctaaagtc
atcacaactgattatgaccgtgactacacctcagctggtaggagatatgacactgacaga
tcattcactgaagattcatttagaacaacaacgtctgcatcaagactgtctccaacttca
gctgaagaccgatatgagagaagctttgattcgtatgcccgatcttccaaacagaagagc
tccaaaggtggtgcctttgccccagttggagtgggaaagccaggttctgctccaaaagct
gaactgcctttcaaattggaatctgatttgttggaggaatcgggttcagatcactccagc
ccagctcgattcatccctcttgctgatgaagaaggagttgaggcaatccgtctggacaca
ctcgaaaaggcgccagataagcctgaagctgtaacaaaagatgaagtacccatagattcc
aaaccaaccgaagaagatgctgagccaaaggaaaaggaggatgtagaagatgagaaggat
gaagactcagaacgcttgcttgctaagaagaagcaggcaatgattgaaacagatcagaag
attgatgacactgaaggagatggaccaccagagtttgtccagcgcctgcgggacatgaca
gtaaatgatggagctcgagttgtcttggaagtccaaataactggtgcacggccaatggat
gttggctggcttcgtaatggacaagacataccagacagtgatgagttccactatgtcagc
cggggcaacattcaccagctggtgatcgccgaggtcttccctgaagactctggcaaatac
acttgtgaagctctgaatgatcatggcgaggcagactgccaatgcacactgaatgtcata
gaggagcctagtgtgagtataagtatcaacgtgagtcaagacatcacagcgacaaccacc
gaccatcaagccatcatggatgatgagaacatccctccagagttctttgaggaaccccag
tctcagactgtggaggaaggagggatggcacgctttgtgtgcgacgtggatggggaaccc
atcccaacagttacatggtcaaaagacgacgtaccaatcagagatggaggccgcttccgg
gtgtactcggacaagttctcccacacttttgaaattcctgttgccctggcaacagatgag
ggagaatatgtgtgtacagccaccaataaggagggccagaccgaatgcggattcagtctg
agagttatccaggatcagacagctgctgttgcagacaagcaaatcattgatgcgactgga
ccacagtccactccacctgtcacttcatctgaacccattgcaatctttgcacctgttgca
caatctgctcctgatcaggacagtgaggtgattgctcagtttgatgacaccatggatgct
atcggtgaaccagttcgattctcctccgattcagaagcacccgtctttgtagaagaactc
caagaccaggtggttgttgaggaaagtgggacaaacttccagtgtcgagtcacgggcaaa
cccctgcctgacatcacctggttctttgaaggccgaccaatcaaatcctccaagtacttc
cagatgagcgaggaggatgacatgtgcatcctgaccatagcagaggcatacaccgaggat
gctgggaaatatagttgccatgccaacaatgaggcaggggaggcagtgacatcagccatg
ttggtggtgcatgaacctgccccaccagctgacatcacaccatcccctgcagctgaatca
atcagccaacaagcgccctcttttgacaagaaaatccaggactgtgaagcacaagccaat
agcgaggctagatttgaatgcactgtcaaagggacgcccattcctgaaaccaaatggttc
aagaatgggaaacccttgaaggaaggcattcgtcacaagctatcccaaggagcagacgga
gtctgctcacttgtcatccccagagcacaaattgaggatagtggcgactatgaatgcaat
gcacagaatgccaatggcggtgcttcatgcatagccaagctcagcgtgaaatcttcaaag
aagctccccttcttgaacaagtttcagcaagacagctcatcatccggtagtgggccaggt
ggcaagaagggccccacaggtcccagccgagggagcagtgtcatggcaagagcacagatg
tttggcaagtag

DBGET integrated database retrieval system