KEGG   Acanthaster planci (crown-of-thorns starfish): 110986169Help
Entry
110986169         CDS       T05078                                 

Definition
(RefSeq) biotin--protein ligase-like isoform X1
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
aplc00780  Biotin metabolism
aplc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    110986169
Enzymes [BR:aplc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     110986169
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     110986169
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     110986169
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     110986169
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_LplA_LipB BPL_C BPL_N ABC_transp_aux
Motif
Other DBs
NCBI-GeneID: 110986169
NCBI-ProteinID: XP_022103513
Position
Unknown
AA seq 894 aa AA seqDB search
MATSSLNGSSSDSEHQIDTDSVQFRQKAKVMNALRCHGARASIAFRKILQEGTISEGDKM
RASFLCETGEQPIISQLLGEKRGKQMLVVHPKQQVDLSKDWTSFIGTTTTSASPYRDPDP
ASSSSLDSVFVLLEAFPPKKDRQGRLNLRKVARERVVKLSGLTTPLAWKSGEPFGILVQA
SANNFGLVGSAYLEGVLELDDGLLVEQIVCVDTIGEPFSLINQDPKTPSPSPFPSASPFH
RSPSGNSLFQRSGSSQKDVKPLRRKHSQEFIKKLEEQQRRLSRKSSSESSDLGSISVEMA
SPGLDDEVLVDIKGHPKFHLGEVEDVSSGDVGNGSQKPPNVLVYTGNDDVDDSRYKIAMT
FLEKFLHRDRYVIYHLKPEQALAHPWADNCMLLLLLMGTEPIPDNTLKKFTDYVKSGGFL
FLLKGQSTTPPKNPSVCTIEYSKALGDEVLSFRAMCLEDPPTMDLFPNGQVKVLAESQGN
AVVAETSFEGSTGKILSSLVQFQLLSPENLVPDTEAFTELKQSNEARHQVIFDLLGRFGL
KCATSELPELTVGYLLGVNERVGRAFMSAIQPSLNDGQLASRFLTMQFSSDPRGVGKVTP
DLLPVITGQRSPQGGSFDFEVYKGNLSTKSLGNVVLYTEVVPTTMTLFESFMFKVPEDVG
VVTIATRMTQGKGRGGNKWLGPIGCAMFSLHVRIPFGSELADKLPFLQHIASAAVVEAVR
SIEGYQDMDLRLKWPNDIYYSDKMKLGGVIVNSSSLDNVFHAIIGCGFNVDNSDPTICIN
DLVRLHNKQTNSDLPLLTVEQLIARAVNQIESLIGGFQREGPKLFLETYYRRWLHSGCKV
RLENESGPEVTVEGLDKSGFLLVRDQEGVLHSVQPDGNSFDMTKNLVLMKERTQ
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccagttcgctgaatggatcctcgtccgactcggaacatcagatcgatactgac
agcgtgcagttcagacagaaggcaaaggtgatgaacgccctgcgttgccatggcgcccgg
gccagcatcgcctttcggaagatcctccaggagggcacgatcagtgaaggagacaagatg
agggcttcatttctttgcgagacgggtgagcaaccaatcatctcacagcttctcggcgag
aaaagagggaaacagatgcttgtggtacatcccaagcaacaagttgatctgtctaaagac
tggacatctttcattggaacaaccaccacgagtgcatcaccctacagggatccagaccca
gcatcttcctcgagcctggactccgtctttgtcctcttggaggccttcccaccgaagaag
gaccgccagggtcgtctgaacctacggaaggtcgcgcgggagcgagtggtgaagctgtca
ggactgaccaccccattggcctggaagtctggcgagccattcggcatcctggtgcaggcg
tctgccaacaactttggactggtgggctctgcctatctggaaggagtgctggagctcgat
gatgggctgctggtggagcagatagtctgtgttgatacaattggtgagcccttcagcctc
atcaatcaagaccccaaaaccccctctccatcccccttcccatccgcctctcctttccac
cgttccccttctggaaacagcctcttccaaaggtcgggttcctcccaaaaggacgtgaaa
cctcttcgcaggaaacactctcaggaattcatcaagaaacttgaggagcagcagcgaaga
ctgtcccgtaagtcctcgtcggagtctagcgatctcggaagcatttcggtcgagatggca
agcccaggacttgacgatgaagtactggtggacatcaaagggcatccaaaatttcacctg
ggagaagtggaagatgtctcctctggggatgttggtaatggctcccagaagcctcccaat
gttcttgtgtatacgggaaatgacgacgtggacgactccaggtacaagattgccatgact
tttcttgagaaattccttcacagagatcgctacgttatctaccatttgaaaccagaacaa
gctttggcccatccgtgggctgacaactgcatgctgcttctcctgttgatgggcactgaa
ccgattcccgataacacgctgaagaagttcaccgattatgtcaagtctggcgggttcctc
ttcttgctcaaggggcaaagcaccactcccccaaaaaacccgagtgtgtgcaccattgag
tactctaaagctctcggggatgaggtgctgtcctttcgagcaatgtgcttagaggatccc
cccacaatggatttgtttcccaacggacaggtgaaggttcttgcagagagccagggaaat
gctgttgttgccgaaacgtcctttgaagggagcacaggaaaaatcctatcttccctagtc
cagtttcaactcctctccccggagaatctggttccagacacagaggctttcacagaactg
aagcagtcaaatgaggcccggcatcaggtgatctttgacctcttaggtcgttttgggttg
aagtgcgcgacctcagagctgccagaactgaccgttggctacttactgggagttaacgag
cgagtaggccgtgccttcatgagcgccatccagccaagcctcaatgatggtcagctggcc
agtcgcttcctaaccatgcagttcagcagtgacccccgtggggtcggcaaagtgacacct
gacctcctgccagtcatcaccggccaaaggtcaccgcagggtggttcgtttgacttcgaa
gtttacaagggtaatctgtcaactaagagcttgggaaatgttgtgctgtacacggaggtg
gtgccgacaactatgacattgtttgaaagtttcatgttcaaggttccagaagatgttggt
gttgttaccatagcaacccgcatgacacaaggcaaagggcgaggtggtaacaaatggctt
ggccccattggctgcgccatgttctctttgcatgtgcgtattcctttcggctcggaactt
gccgacaagctgcccttcttgcagcacattgcctcagcagctgttgtggaggctgtcaga
tccattgaaggctatcaggatatggatctaaggctgaagtggcccaacgacatctattac
agcgacaagatgaaactgggcggtgtcatcgtcaactcaagctctttggacaacgtgttc
catgcaattattggttgcggtttcaacgttgataacagtgaccccactatctgcatcaac
gacctcgtccgtctccacaacaagcagaccaacagtgacctgccgttgctgaccgtagag
cagctcatcgccagagccgtcaatcagatcgaaagcctcattggtgggttccagagagag
gggcccaagttgttcctggagacgtactataggagatggctgcacagtggctgtaaggtg
cgcctggaaaatgagtcagggccagaggtaacggtagaaggactggacaagtctggcttc
ctcttggttagagaccaggagggggtgctacacagtgttcaaccagatggcaacagcttt
gacatgaccaaaaatctggtgctgatgaaggagagaacacagtga

DBGET integrated database retrieval system