KEGG   Acanthaster planci (crown-of-thorns starfish): 110986199Help
Entry
110986199         CDS       T05078                                 

Definition
(RefSeq) ketohexokinase-like
  KO
K00846  ketohexokinase [EC:2.7.1.3]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
aplc00051  Fructose and mannose metabolism
aplc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    110986199
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aplc04147]
    110986199
Enzymes [BR:aplc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.3  ketohexokinase
     110986199
Exosome [BR:aplc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110986199
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 110986199
NCBI-ProteinID: XP_022103578
Position
Unknown
AA seq 309 aa AA seqDB search
MACYTEEKRILIVGLVCLDIINVLDDYPLEDTDSRVNDQLWERGGNAGNTSVVLSQLGVQ
TEFMGTLADNTLSQLMVEDFQQYGVHIDHCIYHKNCTPPASCIIINSSTGTRTILHNNRS
LPELMYEDFELLNLKNYSWIHFEGRNIQEVLKMIDRVIMYNRELTESSERIHISVELEKP
KLEVSIHKVLPKADVVFFSKDVAKAFGCQNGEECVLKFKNDAKPGAVIVCAWGELGAWAI
GSDDEAVHSPAYPPAKIRDTVGAGDTFNAGVIYSISRGQSVLHAVTQGCKVAGEKIGHQG
FRIGTDLAT
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggcttgttatacagaagagaagagaattcttattgtgggtcttgtatgccttgacatc
atcaatgtgttagacgattacccactagaagatacagatagtagagttaatgatcagttg
tgggagaggggcggtaatgcaggcaatacatcggttgtactgtcgcagcttggagtacaa
actgaattcatgggtaccttggcagataatactctgtcacagttgatggtagaagacttc
cagcaatatggagtacacattgatcactgcatatatcacaaaaactgcacacctcccgcc
tcatgtattatcatcaactcatcaacaggaacaagaaccattctacacaacaacagatct
ctcccggaactgatgtatgaagattttgaattgttaaacctgaagaactactcttggatc
cattttgagggtcgaaatatccaagaagtgctgaaaatgatcgacagggtcatcatgtac
aacagagagttaacagaatctagtgaacgtattcacatatctgtggaactggagaaaccc
aagctggaagtttccattcacaaagtgctgcccaaggctgatgtggttttttttagtaaa
gatgtagctaaggcatttggatgtcaaaatggagaagagtgtgtgctcaagttcaaaaac
gatgccaaaccaggcgctgtaatagtttgcgcctggggtgagctgggggcctgggcgata
ggatctgatgacgaagccgtccattccccagcctacccccctgccaaaatacgagatact
gtgggtgcgggagacactttcaacgctggagtcatttactccatatccaggggccaaagt
gtactgcatgctgtcacacagggttgtaaagtagctggagaaaaaattggacatcaaggt
ttcaggattgggactgacctcgccacttaa

DBGET integrated database retrieval system