KEGG   Acanthaster planci (crown-of-thorns starfish): 110986474Help
Entry
110986474         CDS       T05078                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD6-like
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:aplc01002]
    110986474
Enzymes [BR:aplc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     110986474
Peptidases [BR:aplc01002]
 Serine Peptidases
  Family S33
   110986474
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Thioesterase Lipase FSH1
Motif
Other DBs
NCBI-GeneID: 110986474
NCBI-ProteinID: XP_022104049
Position
Unknown
AA seq 334 aa AA seqDB search
MHTIFKLALVPPLMCIGMMMLPFLIFFSPTILTTAAIVFFRPDLVFRLYTRFKMWHIGFR
SKSVTVSKYTFSFAERGQPDPSRPSMLFLHGFSAAQDMWWPFVKHLPKEWHIVAVDMPGH
GKTTRKMSDSFSLPAQAARIRQFTQAVGLRKRPFHLVGISMGGGVAGIYAAKYSEDLAKL
TMFCPAGIQSKIPSEFELAVNDGRLANGLLPEKDEDYSKMLPFLMYEVPKVPSLYWKGMR
LLRKNNNAFYRKVMNDMMAPTSKDSLRANMASISVPTLVIWGEHDKLLHPSGASVLKEGI
PECQVHVLERCGHSLHMERPYKTSKFLRTFAEEE
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcatactatattcaagctggccctggtgccacccctcatgtgcatcggcatgatgatg
ctacccttcctcatcttcttctcgcccacgattctcaccactgcggccatcgtcttcttc
cgtccagacctggtcttcaggctctacacccgcttcaagatgtggcacattggtttccgt
tccaaatcagtcaccgtcagcaagtacaccttttcctttgcagagcgaggtcagccagac
ccttcccgcccttcaatgctgttcctgcatgggttctcagctgcccaggacatgtggtgg
ccatttgtgaagcatttgcccaaggaatggcacattgtggccgtggatatgcctggacat
ggcaagacaactcgtaagatgagcgacagtttctccctgcctgcccaagctgcaaggata
cggcagttcacccaagctgtcggtctgcgtaagaggcccttccatctggtgggaatttcc
atgggcggcggcgtagctgggatttacgctgctaagtactcggaggatctggccaagctc
accatgttctgccccgcaggaatccagtccaaaatacccagtgagtttgagttggctgtg
aatgatggcagacttgctaatggcttgctgccagaaaaggatgaagattacagcaagatg
ttgccgttcttgatgtatgaggtcccaaaagttccaagtctgtattggaaagggatgaga
cttctcaggaaaaacaacaatgcattctacaggaaagtgatgaacgatatgatggcccca
acctccaaggattccctgcgggccaacatggcatccatcagtgtacctaccctggtgatc
tggggcgaacacgacaagttgctccatccttctggggcctccgttctcaaggagggcatt
cccgagtgtcaggtgcacgtgcttgaacgttgtggccactcgctgcatatggagcgacca
tacaagacatctaaattcttgcgcacatttgccgaggaagaataa

DBGET integrated database retrieval system