KEGG   Acanthaster planci (crown-of-thorns starfish): 110987921Help
Entry
110987921         CDS       T05078                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase 1-like
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
aplc00010  Glycolysis / Gluconeogenesis
aplc00030  Pentose phosphate pathway
aplc00051  Fructose and mannose metabolism
aplc01100  Metabolic pathways
aplc01200  Carbon metabolism
Module
aplc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110987921
   00030 Pentose phosphate pathway
    110987921
   00051 Fructose and mannose metabolism
    110987921
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aplc04147]
    110987921
Enzymes [BR:aplc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     110987921
Exosome [BR:aplc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110987921
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase Inositol_P
Motif
Other DBs
NCBI-GeneID: 110987921
NCBI-ProteinID: XP_022106776
Position
Unknown
AA seq 337 aa AA seqDB search
MSEGALQTDFMTLTRFVLEEQRKIPGATGELTQLLNSLLTAIKAVSSAVRKAGIAKLYGI
AGSTNVTGDEQKKLDVLANDLFINSLRSSFTTCALISEENETVIEVDAEQRGKYIVAFDP
LDGSSNIDCLVSIGSIFGIWRNGASDAPTNEQILQPGRKMVAAGYALYGSATMVVLCTGG
TVNGFMLDPAIGEFILTERNIRIKPRGKIYSINEGYTEHWYDEIKEYVETKKNTTPERAA
YGSRYIGSMVADMHRTLVYGGIFLYPAHKKSTKGKLRLLYEGNPMAYVVEHAGGLATTGE
ENILDVQPTNIHQRCPVIMGSSEDVKDFLAIVEKHKK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaaggcgctctgcagactgatttcatgaccctgacgcgttttgttctcgaggaa
caacgcaagattcccggcgcaactggcgagttgactcaactgttgaactcacttctgacc
gccatcaaagccgtgtcgtctgctgtacgtaaagctggaattgctaaactgtatggcata
gcaggcagtaccaatgtaaccggggatgaacagaagaagctggacgtcttggccaatgac
ctcttcatcaattctctccgctcctccttcacgacctgcgccctcatctcagaggagaat
gaaacggtgatcgaggtcgatgctgagcagagggggaaatacatcgttgccttcgatcca
ctcgacggatcgtccaacatagattgtcttgtctccattggttctattttcggcatctgg
agaaatggagccagtgatgcgcccaccaatgaacagatcttgcagcctggtcggaagatg
gttgcagcaggctacgctctctacggtagcgccacaatggttgttctctgcacagggggt
accgtcaatggctttatgctggatcctgccatcggggaatttatcctgacagaacgtaac
atccgtatcaagccacgcggcaagatctacagcatcaatgaggggtacacagaacattgg
tatgatgagatcaaggaatacgtggaaaccaaaaaaaacacaactccagaaagggcggca
tacggctcccgttacatcggttccatggtagctgatatgcatcgcaccttggtgtatggt
ggaatcttcttatacccagcacacaagaagagcacaaaggggaagcttcggcttttgtat
gagggtaatcccatggcctacgttgtggagcatgctggtggcttggcaacaaccggtgaa
gaaaatatcttggacgtccagcccaccaacatccaccagcgctgcccggtcatcatgggc
tccagtgaagatgtcaaagacttcctcgcaattgtcgagaaacacaagaaataa

DBGET integrated database retrieval system