KEGG   Acanthaster planci (crown-of-thorns starfish): 110988120Help
Entry
110988120         CDS       T05078                                 

Definition
(RefSeq) 4-trimethylaminobutyraldehyde dehydrogenase-like
  KO
K00149  aldehyde dehydrogenase family 9 member A1 [EC:1.2.1.47 1.2.1.3]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
aplc00010  Glycolysis / Gluconeogenesis
aplc00053  Ascorbate and aldarate metabolism
aplc00071  Fatty acid degradation
aplc00280  Valine, leucine and isoleucine degradation
aplc00310  Lysine degradation
aplc00330  Arginine and proline metabolism
aplc00340  Histidine metabolism
aplc00380  Tryptophan metabolism
aplc00410  beta-Alanine metabolism
aplc00561  Glycerolipid metabolism
aplc00620  Pyruvate metabolism
aplc01100  Metabolic pathways
Module
aplc_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110988120
   00053 Ascorbate and aldarate metabolism
    110988120
   00620 Pyruvate metabolism
    110988120
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110988120
   00561 Glycerolipid metabolism
    110988120
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    110988120
   00310 Lysine degradation
    110988120
   00330 Arginine and proline metabolism
    110988120
   00340 Histidine metabolism
    110988120
   00380 Tryptophan metabolism
    110988120
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110988120
Enzymes [BR:aplc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     110988120
    1.2.1.47  4-trimethylammoniobutyraldehyde dehydrogenase
     110988120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-GeneID: 110988120
NCBI-ProteinID: XP_022107064
Position
Unknown
AA seq 536 aa AA seqDB search
MAQLGVGRQLIVLSFHARLQLQHLNAGLSRRRSLRKLAMACTSRSVSTFFQKPLNFIGGE
RVAPTDHTQSFKVFEPATGNVLCESPSSSQQDVDRAVAAAKDAFQEWSETPALERARILQ
RAASLVRERVEEFATMETINVGKSISESRVDVYSATDALEFFAGLAPSLAGEHFQYPSGT
FGYTVREPLGVCVGIGAWNFPIQMVGWKSAPALAAGNTMVFKPSPFTPVTAVLYAEALLE
SGLPRGVFNVVQGQAVTGTALTSHPDVAKVSFTGSVPTGKHIMRSCADDLKHVTLELGGK
SPLVIFADADLENAVKGAMLANFLTQGEVCSNATKVYVERSIKDAFVEKLLGRVRSLRLG
DPLKEDTQVGALISKEHMENVLGYIEGAKKQGASVLCGGERVTPEDPKLASGYYLSPCVL
DNLTDDMTIIKEETFGPVLTLLTFDTEEEVTQRANDTPLGLSGGVFTKDIQRAHRVIKNM
RAGSCWINTYNTYPAGWPFGGYKQSGLGRENAAVTLNSYTQLKSVYVEMGDVDSPL
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggctcagctaggagtcggtcggcagttgatagttctgtctttccacgcgcggctgcag
ctgcagcacctcaatgctggtctctcgaggcgacgatctctacggaagttggccatggct
tgcacatcacgttcggtcagcactttctttcagaaacccttgaatttcatcggtggcgaa
cgggtagcaccgacagatcacacgcaaagttttaaggtcttcgagcctgccacagggaat
gtgttgtgcgagtcacctagctctagccagcaggatgttgaccgtgctgtggctgctgcc
aaagacgccttccaggaatggtcagaaactccagcacttgagagggccaggatactgcag
cgtgcagccagcctagtcagggaaagggtagaagaatttgcaaccatggagaccatcaat
gtcggcaaatccatctctgagtctcgtgtcgatgtttactctgccactgatgcactggag
ttctttgctggactggcaccaagtctagcaggtgaacatttccagtaccccagcggcacc
ttcggctacacagtccgagagcccctaggggtttgcgttggcatcggtgcctggaacttc
cccatccagatggtgggctggaaatctgccccagccctggcagccggtaacaccatggtg
ttcaagccctccccgttcaccccggtgactgccgtcctgtatgccgaagcgctgctagag
agtggccttcctagaggtgtcttcaatgttgtccagggtcaggcagtgaccggcactgcc
ctgacctctcaccctgatgtagccaaagtgtccttcactgggagtgtccccactggaaag
catatcatgaggagctgtgccgatgacctgaagcatgtgaccctggagctggggggtaag
tctccactcgtcatctttgctgatgcagaccttgagaatgctgtgaagggagcgatgctg
gcaaacttcctcactcaaggggaggtgtgctccaatgccaccaaggtgtacgtggagcgc
agcatcaaggatgcgttcgtcgagaaactcctgggcagagtcaggtccctgaggctggga
gacccgctgaaggaggacacccaggtgggagcactcatcagcaaagagcacatggagaac
gtgctgggctacattgaaggagccaagaaacagggagcctccgtcctgtgtgggggtgag
agagtcacccccgaagaccctaagcttgccagtgggtattacctctctccctgcgtgttg
gacaacctgacagatgacatgaccatcatcaaggaagagacttttggccccgtgctgacc
ctcttgacctttgacaccgaggaagaggtcacccaacgagcaaatgacactcctctgggg
ctttcaggtggtgtatttacaaaagacattcagcgcgctcaccgcgtcatcaagaacatg
agagcagggtcatgctggatcaacacctacaacacatatcccgccggctggccgttcggc
ggctacaagcagtcggggctgggcagggagaatgccgccgtcacgctcaacagctacacc
cagctcaaaagcgtctacgttgagatgggcgacgtggattccccgctgtaa

DBGET integrated database retrieval system