KEGG   Acanthaster planci (crown-of-thorns starfish): 110989753Help
Entry
110989753         CDS       T05078                                 

Definition
(RefSeq) succinate-semialdehyde dehydrogenase, mitochondrial-like
  KO
K00139  succinate-semialdehyde dehydrogenase [EC:1.2.1.24]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
aplc00250  Alanine, aspartate and glutamate metabolism
aplc00650  Butanoate metabolism
aplc01100  Metabolic pathways
Module
aplc_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    110989753
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    110989753
Enzymes [BR:aplc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     110989753
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 110989753
NCBI-ProteinID: XP_022110048
Position
Unknown
AA seq 519 aa AA seqDB search
MQSILSTICLFRQCAWKVSALHKHPPRLPSCRLHQSSRINDCLLRDQAYIGGSWVSSNNS
FPVINPANGIEITSIPDLGVTETTDAIQAAYDAFQGWSETTAKERSVILRRWYDLMIENQ
EELAKILTAEMGKPLAEAKGEILYAASFFDWFSEEAKRCYGDVLPTIVKSKRMMFLKQPV
GVAAMITPWNFPSAMITRKVGAALAAGCTTVVKPAEDTPLSALALIPLAEEAGVPPGVFN
VVTCSRDHAAEVGKVLCESPLVSKISFTGSTATGKILLQQASSTVKRVSMELGGNAPFIV
FDSASVDAAVDGAIACKFRGMGQTCVCANRIYVQDGIYTEFSQKLAAKISNLVIGDGMES
GVTQGPLINDKAVEKVERHIDDAISRGAKVLTGGKRHKLGRTFFEPTLLLDVSQDALVCS
EETFGPLAPLIRFETEAEVVALANASPFGLASYFYSNDIGQIWRVAEKLESGLVGINEGL
LSSEAGAFGGIKQSGLGIEGSKYGINEYLNIKYACFGGI
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgcagtccatcttgagtaccatctgtctctttaggcagtgtgcatggaaagtatcagcc
ctacacaaacatcctcccagacttccttcttgtcgtctgcaccagtccagtcgaatcaat
gattgcctgcttcgtgatcaagcttacattggaggttcctgggtgtcaagtaacaattca
tttcctgtaattaacccagccaatgggattgaaattaccagtatcccagatcttggagtt
acagaaactacagatgcaatccaggctgcctatgatgcattccaaggatggtcagagaca
actgctaaggaaaggagtgtaatcctaaggcgatggtatgatctcatgattgagaaccag
gaggaattggccaagattctaacagctgaaatgggaaaacctctggcggaagctaaggga
gaaatcctttatgcggcgtctttcttcgattggttttcggaagaagccaaacgttgctat
ggggatgtcttgccaaccattgtgaagagcaagcgcatgatgttcttaaagcagcctgtg
ggtgtggcagctatgataacaccgtggaattttccaagtgctatgatcacacgtaaggtg
ggtgctgccttggctgctggttgcactacagtcgtcaaacctgccgaggacacaccccta
tcagctcttgcattaataccattagctgaggaagctggtgtacctcctggtgttttcaat
gtagtaacttgctccagagatcatgctgctgaagttggcaaagttctttgtgaaagtcca
ctggtttcaaagatatccttcactggatcgacagctactggcaagattctcctccagcaa
gcttccagcacagtgaaacgggtgtcgatggagctgggtgggaatgcccctttcattgtc
tttgattctgccagtgttgatgcagcagttgatggagctattgcttgcaaatttcgtggc
atgggacagacctgtgtctgtgctaatcgcatctatgtgcaggatgggatctacacagaa
ttcagccagaagctggctgcaaagattagcaaccttgtaattggagatgggatggagtca
ggggtgacacaaggaccacttattaatgacaaagctgttgagaaagttgaaaggcacatt
gatgatgccatatcacgtggggctaaagttctcactggaggaaaacgacataaacttgga
aggactttctttgagcctactctcttgttggatgtctcccaagatgctttggtgtgctct
gaggagacatttgggccccttgctccactgataagatttgagacagaggcagaagttgta
gcccttgccaatgcatctccatttggcctggctagttacttctactccaacgacattggt
cagatctggcgagtggctgagaagctagaatcaggcttggttggcatcaatgagggtctt
ttgtcctcagaggccggagcatttggtggtatcaagcagtcaggccttgggatagagggc
tctaaatatggaattaatgaatacctgaacatcaagtatgcctgctttgggggcatatga

DBGET integrated database retrieval system