KEGG   Acanthaster planci (crown-of-thorns starfish): 110991199Help
Entry
110991199         CDS       T05078                                 

Definition
(RefSeq) endoplasmic reticulum resident protein 44-like isoform X1
  KO
K17264  endoplasmic reticulum resident protein 44
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aplc04131]
    110991199
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aplc04147]
    110991199
Membrane trafficking [BR:aplc04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    110991199
Exosome [BR:aplc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110991199
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin_6 Thioredoxin Calsequestrin HyaE Thioredoxin_2 Thioredoxin_7 Thioredoxin_8
Motif
Other DBs
NCBI-GeneID: 110991199
NCBI-ProteinID: XP_022112150
Position
Unknown
AA seq 426 aa AA seqDB search
MVAGERRVVRSFVDTMDARFVLKCLPFVLLILVSSFSHTSTQTGFTMELSRSNFDQVIAT
NEVVFVNFYANWCRFSQMLKPVIEDTAKAAREEFRQPGQVVVAAVNCETEDAIAKRYHIS
KYPTLKMFRNGQLAKREYRSQRSKDAFMNFLRDQVKDSINQMQTKEDVQKIDQSKRNIIA
YFKAVNTNEYSVFRRVASALRDDCSFHVGIGENFRSETVSGDNIMFRPPRTSGQDMLYMG
SMLNFNLFHTWAQDKCIPLVREITFENGEELTEEGLPFLILFHRPEDADVVKRFNSIISR
ELIGDKGSVNFLTADGTKFTHPLHHLGKTPKDLPVIAIDSFRHMYLFPNVQEVDAPGKLK
QFVDDLHSGKLHREFHHGPDKVTPQEPAKATSGSQEPAKKAPTDPPESTFIKLKPSGNRY
SFRDEL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggttgccggcgagcgacgagtggttcggtctttcgtggatacgatggatgcaaggttc
gtcttgaagtgtctgccgtttgtgctgctgattttggtgtcgtcgtttagtcacacgtca
acccagacggggtttacgatggagctgtcgcgatccaacttcgatcaagtcattgccact
aacgaggtggtctttgtcaacttctatgccaactggtgtcgtttcagtcagatgctgaag
ccggtgatagaagacactgccaaggcagcgagggaagagttcaggcaacctggccaagtg
gtggtagcggcggtgaactgtgaaactgaagatgccattgccaagaggtaccatatctcc
aagtatccgaccctgaagatgttccggaatggacagctggcgaaacgggagtatcgatcc
cagcgatccaaggatgcctttatgaacttcctgagagaccaggtcaaggacagcatcaat
cagatgcagaccaaagaggatgtccaaaagattgatcaatccaagcgcaacatcattgcg
tacttcaaggcagtgaacacaaacgagtactctgtcttcagacgggttgcaagcgctctc
agagatgactgttccttccacgtcggaattggtgagaacttcaggtcagaaacagtgtct
ggagataacatcatgttcagaccgccaaggactagtggccaggatatgctgtacatggga
tccatgttgaacttcaacctgtttcacacctgggcacaggacaaatgcatcccgctggtg
cgggaaattacctttgaaaacggagaggaattgacggaggaaggcttgccattcctgata
ctgttccacagacccgaggatgctgatgttgtcaaacgattcaacagtatcatcagcagg
gagctgattggcgataagggaagtgtcaacttcttaacggcagacggcaccaagtttacg
cacccactgcatcatttagggaagacccccaaggatctcccagtgattgccatcgatagc
ttcaggcacatgtacctgttccctaatgtgcaagaagtagacgcccccgggaaactcaag
cagtttgtcgacgacctgcactcagggaaacttcaccgggagttccaccacggaccggac
aaggtgaccccacaggagccagccaaagctacctccgggagccaggaaccagcaaagaag
gcccccaccgaccctcccgagagcaccttcatcaagctgaagcctagcggaaatcgatac
tctttccgtgatgagctttga

DBGET integrated database retrieval system