KEGG   Alpha proteobacterium HIMB5: HIMB5_00000200Help
Entry
HIMB5_00000200    CDS       T02250                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
apm00020  Citrate cycle (TCA cycle)
apm00310  Lysine degradation
apm01100  Metabolic pathways
apm01110  Biosynthesis of secondary metabolites
apm01120  Microbial metabolism in diverse environments
apm01130  Biosynthesis of antibiotics
apm01200  Carbon metabolism
Module
apm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:apm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HIMB5_00000200
  Amino acid metabolism
   00310 Lysine degradation
    HIMB5_00000200
Enzymes [BR:apm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     HIMB5_00000200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AFS46793
UniProt: J9YTQ5
Position
21442..22728
Genome map
AA seq 428 aa AA seqDB search
MSEKIVVPVLGESITEATVAKWLKKEGDHVEADEPIVELETDKVNLEVPSPIDGVLSEIV
SKDGSTVEVGALLGSISQNGSATSPKQPQVKKEPEIKKENNVVNLETPKKKEIKVEKQKE
EDAPLRLTKEVKKPKSPTNLNNSKQVLSPAVRKMVEEKKIDLSRVRGSGKDGRVLKGDLI
SLMGANPPPSERKAQFGEEERIKMSRLRLTIAKRLKQAQENAALLTTFNEVDMTGIMEMR
KENQEDFQSRYGIKLGFMSFFVKACVAALKTFPAVNAEIDGEEIIYKNYYNISFAVGTDK
GLVVPVLRNADELSFADIEKDIKVISEKARDGKLTIEDLQGGTFTISNGGVYGSMLSTPI
LNLPQSGVLGMHNIVERPVVVDGEIKIRPIMYLALSYDHRIIDGKESVSFLKMVKENLED
PRRLFLDI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaaaattgtcgttcctgttttaggcgaaagtattactgaagccaccgttgct
aaatggttaaaaaaagagggtgatcatgttgaagcagatgagcctatcgtagaattagaa
acggataaagtaaatttagaagtgccttcaccaatagatggtgttttaagtgaaatagtt
tcaaaagatggatcaacagttgaggttggggctttattagggtctattagtcaaaatgga
tctgctacatctccaaaacaaccccaagtaaaaaaagaaccagaaattaaaaaagaaaat
aatgttgttaatttagaaacaccaaagaaaaaagaaattaaggtagaaaaacaaaaagaa
gaagatgctcctttaagattaacaaaagaggttaaaaaaccaaaatctccaacaaattta
aataattctaaacaggttttatctccagcagtgagaaaaatggtagaagaaaaaaaaatt
gatctaagtagagtaagaggttctggaaaagatggaagagttttaaaaggagaccttatt
agtttgatgggggcaaacccaccaccttctgaaagaaaagctcaatttggtgaagaagaa
agaatcaaaatgagcagactaagattaactatagcgaagagattaaagcaggctcaagaa
aatgcagcattgttaactacattcaatgaagttgatatgacaggcataatggaaatgaga
aaagagaatcaagaagattttcaaagcagatatggaattaaattaggatttatgtcattt
tttgtaaaagcttgtgtggcagctttaaaaacattcccagcagtaaatgcagaaattgat
ggagaggaaatcatttataagaactactacaatattagttttgctgttggaacagacaaa
ggacttgtagtgccagttttaagaaatgcagacgaactatctttcgcggacatcgaaaaa
gatattaaagtaatttctgaaaaagctagagatggaaaattaacgattgaggatttacaa
ggtggtacatttacaatcagtaatggaggtgtatatggatcaatgctatcaacaccaata
ttaaatttgcctcaatctggagttctaggaatgcacaatattgtagaaagacctgttgtt
gtagatggggaaattaaaataagaccaattatgtatttagcgttatcttatgatcacaga
attattgatggaaaagaatcagtctcttttttaaaaatggtaaaagagaacttagaagat
ccaagaaggttatttttagatatttaa

DBGET integrated database retrieval system