KEGG   Alpha proteobacterium HIMB5: HIMB5_00001140Help
Entry
HIMB5_00001140    CDS       T02250                                 

Definition
(GenBank) 2-haloalkanoic acid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
apm00625  Chloroalkane and chloroalkene degradation
apm01100  Metabolic pathways
apm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:apm00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HIMB5_00001140
   00361 Chlorocyclohexane and chlorobenzene degradation
    HIMB5_00001140
Enzymes [BR:apm01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     HIMB5_00001140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Put_Phosphatase Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: AFS46887
UniProt: J9YV73
Position
complement(111077..111739)
Genome map
AA seq 220 aa AA seqDB search
MKNIKAIIFDAYGTLFDVNSAAEKCKDKIGDKWEAFANYWRTTQLEYTWLRSLMKRHKDF
WQVTEDSLDKSMKVFNIDNSMRNELLDLYKILSPYPEVPEILKSLKEKDYKLSILSNGTP
SLLNELVKGNNLENLFDDVFSIEEVGIYKPDSKVYDLPIKKYKIKNNEVAFLSANTWDVS
GGGNYGFNSIWVNRNNNVFDNLDYKPENEIKNLKELVDLI
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatattaaagcaataatttttgatgcttacggaacgttgtttgatgtgaattct
gcagctgaaaaatgcaaagataaaattggtgataagtgggaagcatttgcaaattattgg
agaacaacacaattagaatatacatggcttagaagcttaatgaaaagacacaaagatttt
tggcaagttacagaggatagtttggataagtctatgaaagtttttaatatagacaattca
atgagaaatgaattattagatctttataaaattctatctccttatccagaagtaccagaa
attttaaaatctttaaaagagaaagactataaactttctatactttcaaatggaactcct
tctctacttaatgagcttgtaaaaggtaataatttagaaaatttatttgatgatgttttt
tcaattgaggaagttggaatttataaaccagattcaaaagtttacgatttaccaattaaa
aaatataaaattaaaaacaatgaagttgcttttttaagtgcaaatacttgggatgtatca
ggtggtggtaattatggttttaattcaatttgggtaaatagaaataataatgtttttgat
aaccttgattacaagcctgagaatgaaatcaaaaatttaaaagaattagttgatcttatc
taa

DBGET integrated database retrieval system