KEGG   Alpha proteobacterium HIMB5: HIMB5_00002720Help
Entry
HIMB5_00002720    CDS       T02250                                 

Definition
(GenBank) Amidinotransferase
  KO
K00613  glycine amidinotransferase [EC:2.1.4.1]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
apm00260  Glycine, serine and threonine metabolism
apm00330  Arginine and proline metabolism
apm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HIMB5_00002720
   00330 Arginine and proline metabolism
    HIMB5_00002720
Enzymes [BR:apm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.4  Amidinotransferases
    2.1.4.1  glycine amidinotransferase
     HIMB5_00002720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidinotransf PAD_porph
Motif
Other DBs
NCBI-ProteinID: AFS47041
UniProt: J9YVP5
Position
262808..263917
Genome map
AA seq 369 aa AA seqDB search
MTKKIVNSWNEWDPLKHVIVGRADGTCIPAPEPALDAKVPEDSDMRGQFGPRTKDTVDKA
NQLLDDFSNMLKKRGIKVDRPTPIDFNQKTSTPDWETETMFGCMPPRDVLLTVGNEILEA
TMSYRCRWFEYLCYRPLLKEFYNADPNMRHESAPKPRLTDADYHKDYLSDKIGVQKRLEW
TEKKFFVTTEEEPLFDAADILRFGKDLVVQHGFTTNLKGIDWIKRHFKDHRVHAVNFPGD
PYPIHIDATFTPIKEGLIINNPQRRLPKEQRKLFEDNGWEIIDAAQPAHNEPPPLCYSSV
WLSMNVLVLDPKTVCVEKSEVYQAEQLDKLGMEVVPVDLRDAYAFGGGLHCCTADVYREG
ELKDYFPKQ
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaaatagtaaatagttggaatgaatgggatccattaaaacatgttattgtt
ggaagagcagatggcacatgtataccagctcctgaaccagcattagatgcaaaagtacca
gaagactctgatatgagaggacaatttggtccaagaacaaaagatactgtagataaagct
aatcaacttttagatgatttttctaatatgcttaaaaaaagaggaattaaagttgataga
ccaacaccaatagattttaatcaaaaaacttctacacctgattgggaaacagaaactatg
tttggttgtatgcccccaagagacgtgcttttaaccgttgggaatgaaatactagaggca
actatgagttacagatgtagatggtttgagtatttatgttacagaccattgttgaaagaa
ttttataatgctgatcctaatatgagacatgaatctgcaccaaaaccaagattgactgat
gcagattatcataaagactatttatctgataaaattggtgttcaaaaaagattagaatgg
actgaaaaaaaattttttgtaactacagaagaagagccgctctttgatgctgcagacata
cttagatttggaaaagatttagttgttcaacacggttttacaacaaatttgaaaggtatt
gattggataaaaagacatttcaaagatcacagagttcatgcagtaaattttcctggagat
ccttatccaattcacattgatgcaacatttactccaattaaagaaggattaataattaac
aaccctcaaagaaggcttccaaaagaacaaagaaaattatttgaagataatggttgggaa
attattgatgctgcacaacctgctcacaatgagccaccaccattatgttattcttcagta
tggctatctatgaatgtacttgttttagatcctaagactgtatgtgtagaaaaaagtgaa
gtatatcaagcagaacaacttgataaattgggtatggaagttgttccagttgatcttaga
gatgcctatgcttttggtggaggattacattgttgtacagcagatgtttatagagaaggt
gaactaaaagactattttccaaaacaataa

DBGET integrated database retrieval system