KEGG   Alpha proteobacterium HIMB5: HIMB5_00009260Help
Entry
HIMB5_00009260    CDS       T02250                                 

Definition
(GenBank) Formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
apm00670  One carbon pool by folate
apm01100  Metabolic pathways
apm01120  Microbial metabolism in diverse environments
apm01200  Carbon metabolism
Module
apm_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:apm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    HIMB5_00009260
Enzymes [BR:apm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     HIMB5_00009260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS Nas2_N
Motif
Other DBs
NCBI-ProteinID: AFS47678
UniProt: J9YVX8
Position
845390..847069
Genome map
AA seq 559 aa AA seqDB search
MPKSDIEIAREAKMQPIKEILDKINVPDEPEAFSPMGRHIAKINLEYLDKLKSNKDGKLI
LVTAITPTPAGEGKTTTSVGLNDGLNKIGKKSIVCLREPSLGPSFGMKGGAAGGGYAQVV
PMEQINLHFTGDFHAITSAHNLLSALIDNHIYWGNKLNIDVRRVVWKRVMDMNDRSLRSI
VVDLGGVANGFPRQDGFDITVASEIMAIFCLATDLNDLEKRIGNITIGYTRDKKAVYAKD
LNAQGPMTVLLKEAIRPNVTQTLENNPAIIHGGPFANIAHGCNSVIATKAGLKLSDYVVT
EAGFGADLGAEKFLDIKCRKSGIKPDCVVIVATIRALKMHGSVAKDDLKKENIDALKKGL
VNLERHINNTRKFGLPVTIAVNHFITDTDNEMNALLDFCKTLGVKASKCTHWSDGGEGTK
ELAKNVVEICEENKSTFKYLYEDKLPLFKKIEKIAQEIYHASEVVADTKTRQQLKDFEEK
GYGNLPVCIAKTQYSFSTDPNLKGAPTGHVLPVREVRLSSGAEFIVVVCGEIMTMPGLPR
VPAADSIRLNAKGEIEGLF
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagtcagatatagaaatagcaagagaagcaaaaatgcaacctatcaaggagatc
cttgataagattaatgtaccagatgagcctgaagcctttagcccaatgggcagacatatt
gcaaaaataaatcttgaatatcttgataaattaaaaagtaataaagacggaaaactaatt
ctagttacagcgatcactcctacgccagctggagaaggtaaaacaactacatctgtgggc
ttaaacgatggtttaaataaaattggaaaaaaatccatcgtatgtttaagagagccaagc
ttaggtccttcatttggaatgaaaggtggtgcagctggtggtggttatgctcaagttgtt
cctatggaacaaatcaatttacattttactggtgactttcatgccattacatctgcgcat
aatttactttcagcgctgattgataatcatatttattggggaaataaacttaatatagat
gttagaagagtagtctggaaaagagtaatggatatgaatgatagatcattaagatctata
gtagttgacttaggtggtgtagctaacggttttcctagacaagatggttttgatataact
gttgcttcagaaataatggctatattttgtctagcgacagatttaaatgatttggaaaaa
agaattggaaatattactatcggatatactagagataaaaaagctgtttatgctaaagac
ttaaatgcacaaggtccaatgactgttcttttaaaagaagctattagaccaaatgttact
caaactttagaaaataaccctgcaattattcatggcgggccatttgcaaatatagcacac
ggatgtaattcagtaatagctactaaagcgggtcttaaactatcagactacgttgtaaca
gaagcaggatttggtgctgaccttggagctgaaaagtttttagatattaaatgtagaaaa
tcaggaattaaaccagattgtgtagttattgttgcaactattagagctttaaagatgcat
ggaagtgtagcaaaagacgatcttaaaaaagaaaatattgatgccttaaagaaaggttta
gttaatttagaaagacacattaataatacaagaaaatttggtctaccagtaactattgct
gttaatcactttataactgatacagataatgaaatgaatgctttgttagatttttgcaaa
actcttggtgttaaagcctctaaatgtactcactggtctgatggtggagaaggcacaaaa
gaattagcaaaaaatgtagttgaaatttgtgaagaaaataaaagcacgtttaaatattta
tacgaagataaacttccattgtttaaaaaaatagaaaaaatcgctcaagaaatttatcac
gctagtgaagttgttgctgatactaaaacaagacaacagttaaaagattttgaagaaaaa
ggttatggaaatttaccagtgtgtattgctaaaacacaatatagtttttcaacagatcct
aatctcaaaggagctccaactggacatgttttaccagtaagagaagtaagattatcatca
ggagcagagtttattgtggtggtatgtggagagataatgacaatgccaggattaccaaga
gttccagctgcagactcaattagacttaatgctaagggtgagatagaaggattattttaa

DBGET integrated database retrieval system