KEGG   Alpha proteobacterium HIMB5: HIMB5_00011180Help
Entry
HIMB5_00011180    CDS       T02250                                 

Definition
(GenBank) Asparagine synthase,glutamine amidotransferase family protein
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
apm00250  Alanine, aspartate and glutamate metabolism
apm01100  Metabolic pathways
apm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apm00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HIMB5_00011180
Enzymes [BR:apm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     HIMB5_00011180
Peptidases [BR:apm01002]
 Cysteine Peptidases
  Family C44
   HIMB5_00011180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 QueC NAD_synthase tRNA_Me_trans PAPS_reduct ThiI
Motif
Other DBs
NCBI-ProteinID: AFS47866
UniProt: J9YY29
Position
1028871..1030709
Genome map
AA seq 612 aa AA seqDB search
MCGIAGVIKKDNSKEFSVAKINEILKLMSTRGPDFQKHIPFKVNQNLKIDLFHSRLAIID
PTNNSNQPFEDENGILSFNGEIYNYLELRKILQQKNIKFKTKSDTEVLSKMLHYYGERAL
EKLDGMWSFFYFSKRKKTILVSRDRFGEKPLYYYKSKKDFFFGSNINYISKLMKRKLSIN
YEKLSDYLYYGFRNINLDNKSFLKNIFELEKSCYLKIDENLNITKKKYWNFKKTKINNKL
KYPDSVKNLREIILQNINTRLRSNFKIACLLSGGIDSSALAILASKKFKKNIKLYSIKSN
DKNYDETDNIDLIVKKTSLEHKYIELERTNKTSYLEKLIEDAKSPINSITFYLYALINKH
IRADKCRVLFTGFGADEMFGGYYVHYLYFLKSISKKKNFKKQLSDWKIYVLKHINNPNLM
DIEKFFKKKTFNINEIIGNDKIKKYFKKDHILKSKVANYNKDFFKNILSQDLFSHMTPPH
LKDSDQISMYNSIENRSPFLSEKIYDFCFSQPNNFLINDGYNKKILRDAMKPFVPSRILN
NSNKIGFNQNSKNVFNFKNKRIKDIMYSNSYLNSLINISKIEKLIESNETSNNESHLLFS
ILNSAIFLNQNN
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattgcaggtgtcataaaaaaagataattcaaaagaattttctgtagcaaaa
ataaatgaaattttaaagttaatgtccacaagaggacccgattttcaaaaacatatacca
tttaaggtaaatcaaaatttaaagattgatttatttcattcaagattagcaataattgat
ccaacaaataactctaatcaaccctttgaagacgaaaatggaatactttctttcaatggt
gaaatttacaattatttggaattaagaaaaattcttcaacaaaaaaacattaaatttaag
acaaaatctgacacagaagttctttccaaaatgcttcattactatggtgaaagagcctta
gaaaaattagatggtatgtggtcatttttttatttttcgaaaagaaaaaaaacaatttta
gtttcaagagatagatttggagaaaaacctctttattactataaatcaaaaaaagatttt
ttttttggatcaaacattaattatatttccaaactaatgaaaagaaaattaagtattaat
tatgaaaaattaagtgactatttatattatggttttagaaatataaatttagataataaa
tcttttttaaaaaatatttttgaattagaaaaatcttgttatttaaaaattgatgaaaat
ttaaacattaccaaaaaaaaatactggaattttaaaaaaacgaaaattaataataaatta
aaatatccagatagtgtaaaaaatttgcgagaaattattttacaaaatataaatacgaga
ttaagatcaaactttaaaattgcctgtctattaagtggtggaatagactcaagcgcacta
gcaatattagcatcaaaaaaattcaaaaaaaatatcaaactttattcaattaaatccaat
gataaaaattatgatgagacagataatattgatttaattgttaaaaaaacttctcttgaa
cacaaatatattgaattagaacgcacaaataaaacgagttatttagaaaaacttattgaa
gacgcaaaatctccaataaattcaattactttctatctctatgcattaattaataaacat
attagagctgataaatgtagagttttatttactgggtttggagctgatgaaatgtttggt
ggatattatgttcactatctctattttctaaaatctatttcaaaaaaaaaaaactttaaa
aaacaattaagtgattggaaaatctacgttttaaaacacataaataacccaaatttgatg
gatatagaaaagttttttaaaaaaaaaacatttaatataaatgaaattattggtaatgat
aaaattaaaaaatattttaaaaaagatcacattctaaaatcaaaggttgcaaattataat
aaagatttttttaaaaatattttatctcaagatttgtttagtcatatgacgcctcctcac
ttaaaagactcggaccaaatttctatgtataattctatcgaaaataggtcaccttttcta
agtgaaaagatttatgatttttgtttctctcagccaaataattttcttatcaatgatggt
tataataagaaaattttgagggatgccatgaaaccttttgttccaagtagaatattaaat
aactctaacaagattggctttaatcaaaattctaaaaatgtttttaattttaaaaataaa
agaattaaagatattatgtattcaaattcgtatctaaacagtcttataaatattagtaaa
atagaaaaattaattgaatcaaatgaaacatcaaataatgaaagtcatcttttgttttct
atacttaattcagcaatttttttaaatcaaaataattga

DBGET integrated database retrieval system