KEGG   Alpha proteobacterium HIMB5: HIMB5_00012860Help
Entry
HIMB5_00012860    CDS       T02250                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
apm00071  Fatty acid degradation
apm00072  Synthesis and degradation of ketone bodies
apm00280  Valine, leucine and isoleucine degradation
apm00310  Lysine degradation
apm00362  Benzoate degradation
apm00380  Tryptophan metabolism
apm00620  Pyruvate metabolism
apm00630  Glyoxylate and dicarboxylate metabolism
apm00640  Propanoate metabolism
apm00650  Butanoate metabolism
apm00900  Terpenoid backbone biosynthesis
apm01100  Metabolic pathways
apm01110  Biosynthesis of secondary metabolites
apm01120  Microbial metabolism in diverse environments
apm01130  Biosynthesis of antibiotics
apm01200  Carbon metabolism
apm01212  Fatty acid metabolism
apm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:apm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HIMB5_00012860
   00630 Glyoxylate and dicarboxylate metabolism
    HIMB5_00012860
   00640 Propanoate metabolism
    HIMB5_00012860
   00650 Butanoate metabolism
    HIMB5_00012860
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HIMB5_00012860
   00072 Synthesis and degradation of ketone bodies
    HIMB5_00012860
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HIMB5_00012860
   00310 Lysine degradation
    HIMB5_00012860
   00380 Tryptophan metabolism
    HIMB5_00012860
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HIMB5_00012860
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HIMB5_00012860
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HIMB5_00012860
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:apm04147]
    HIMB5_00012860
Enzymes [BR:apm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HIMB5_00012860
Exosome [BR:apm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HIMB5_00012860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C DUF3654 ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-ProteinID: AFS48026
UniProt: J9YYK9
Position
complement(1181958..1183127)
Genome map
AA seq 389 aa AA seqDB search
MHEIVIVKALRTPIGTYKGSLKNFSADKLGTEVIKNLINQSNLTFEEIDEVIMGQVLTAG
QGQNPARQASVNAGIPISKPAHIINQVCGSGLRAIISGYQSIMLNDSKVVISGGQENMSK
APHSIFYREEKKFNENQLHDTMIKDGLIDAFNNYHMGVTAENVSQKYGISRKEQDEFALN
SQNKAKNAINNKLFKNELIKITDEKNKIILEIDEHPRINLSIQDLNKLKTVFKENGTVTP
GNSSGINDGAAGVILTTKKIAETKSLEILGKIISWSSVGVEPSLMGLGPIEAIKSAVKKA
NWDIDEVDLFEINEAFAAQSIAVIKELNLDYEKINVNGGAIALGHPIGASGARIVVTLLH
EMKRRKVKKGCAALCIGGGMGIAMCIERI
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgcatgaaattgtaattgttaaagcattacgtactccaattggaacgtataaaggttca
ttaaaaaattttagtgcagataaacttggaacagaagtgattaaaaatttaattaatcaa
tctaacttaacatttgaagaaattgatgaagtaattatggggcaagttttaacagctgga
caaggtcaaaaccctgcaagacaagcatcagttaatgcaggtataccaatttcaaaaccg
gctcatatcattaatcaagtatgtggttctggattaagagcaataatatcagggtatcaa
tcaattatgttaaacgactctaaagttgtgatttctggcggacaagaaaatatgtctaaa
gcacctcattcaattttttatagagaagaaaaaaaatttaatgaaaatcaattgcatgac
accatgataaaagatggtttgatagacgcattcaataattaccatatgggtgttaccgca
gaaaatgtttctcaaaaatatggtatctctaggaaggaacaagatgaatttgcactaaat
tctcaaaataaagcaaaaaatgcgattaataataaattatttaaaaatgaattaattaaa
attacagatgaaaaaaataagattattttagaaatagatgaacaccctaggataaatcta
agtattcaagatctaaataaattaaaaacagtttttaaagaaaatggaactgttacacct
ggtaactcatccggtattaatgatggtgctgcaggtgttattctaacaacaaaaaaaatt
gcagaaacaaaaagtttagaaattttaggcaagataatttcatggagttctgtgggggtt
gagccatcgttaatgggtttaggaccaatagaagcaattaaatcagctgttaaaaaagca
aattgggatattgatgaagttgatttgtttgaaattaatgaagcttttgcagctcaaagt
attgcagttattaaagaattgaatttagattatgaaaaaataaatgtgaatggtggagcg
attgctttaggacatccgattggcgcttcaggtgctagaattgtagttactttgttacat
gaaatgaaacgaagaaaggtaaaaaaaggctgtgccgctctttgtattggtggcggtatg
ggaatcgcaatgtgtattgaaagaatataa

DBGET integrated database retrieval system