KEGG   Pseudarthrobacter phenanthrenivorans: Asphe3_00690Help
Entry
Asphe3_00690      CDS       T01435                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
apn  Pseudarthrobacter phenanthrenivorans
Pathway
apn00010  Glycolysis / Gluconeogenesis
apn00020  Citrate cycle (TCA cycle)
apn00620  Pyruvate metabolism
apn01100  Metabolic pathways
apn01110  Biosynthesis of secondary metabolites
apn01120  Microbial metabolism in diverse environments
apn01130  Biosynthesis of antibiotics
apn01200  Carbon metabolism
Module
apn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Asphe3_00690
   00020 Citrate cycle (TCA cycle)
    Asphe3_00690
   00620 Pyruvate metabolism
    Asphe3_00690
Enzymes [BR:apn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Asphe3_00690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ADX71288
UniProt: F0M5F6
Position
complement(68773..70221)
Genome map
AA seq 482 aa AA seqDB search
MGEFRMPSLGADMDHGKMVEWLVKPGDYVHRGDVVAVVDTDKTVMDIETFEEGVVAELLV
DIGTTVPIGTPLARITATPDDGTAPPAPGAPQEARMENHALVSPPVRHLAHQLGVDPAAI
RGTGKHGAVTRADVEHAAAPSGAPGDTARQAGQEAMPAAAAARPGRVRSSPRARRLAAER
GLDIASLAGSGPGGAVTEDDVLRAPAAIAPTGPEPAGQAATATEETAPGQIPPEPAGQDQ
AGQEAAPAPAVAAVPAAEGREREAGLRRAVGALMSKSKKTIPHYYLSSTLDMGPAMAWMQ
SVNLQRPVSARLVPSALLLKAAALAAKAVPEVNGFYLDDEFRPSSSVHLGVAVALRKGGI
VAPAIHDADQLTVDALMERLRDLVGRARAGRLQRAEMADPTITVTNLGELGVDSVFGVIY
PPQVAMVGLGRVMEQAWAHDGMLGVRPVVTATLSADHRVSDGLRGARYLAQLDELLQKPE
EL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgagttccggatgccgtccctgggggcggacatggaccacggaaagatggtggag
tggctggtcaaacccggcgactacgtccaccgcggcgatgtggtggccgtggtggacacg
gacaagaccgtcatggacatcgagaccttcgaggaaggagtggtggccgagctcctggtg
gacatcggcaccaccgtcccgatcggcactccgctcgcccgcatcacggcaacccctgac
gatggaacggcaccgcccgcgcctggagctccgcaggaagctcgcatggagaaccacgcg
ctggtttcacccccggtgcgccacctcgcccaccagctgggagtggaccctgcggccatt
cggggcaccgggaagcatggtgcggtgacacgtgccgacgtggagcatgccgcagccccg
tcgggggcaccaggggacacagcgcggcaggccgggcaggaagccatgcccgctgcggca
gccgcccggcccggccgcgtgcggtcgtcgccgcgtgcacggcggctcgctgccgagcgt
ggactggacatcgcctcgctggctggaagcggtcccggcggcgccgttacggaggacgac
gtcctccgggccccagctgccattgcccccactggcccggagcctgctggacaggccgcc
actgcgaccgaggaaaccgcaccgggccagatacccccggaacccgcagggcaggatcag
gcagggcaggaggcagcgcctgcaccggcggtagcggctgtccccgccgcggagggccgt
gagcgcgaggcgggcctgcgccgggcagtcggcgctttgatgtccaagtccaagaagacc
atcccgcactactacctcagcagcacgctggacatgggcccggccatggcttggatgcag
tcagtcaacctgcagcgccccgtgtccgcgcggctggtgccgtctgcgctgctgctgaag
gcagccgccctcgcggcgaaagcagttccggaggtcaacgggttttacctggacgacgag
ttccgtcccagcagttcggtacacctcggcgttgccgttgccttgaggaaagggggcatc
gtggcgcccgccatccatgacgcggaccaactgaccgtcgacgccctgatggagcggctg
cgggacctcgttggacgggcccgggcgggaaggctgcagcgggccgaaatggcagatccc
accatcaccgtcaccaacctgggcgagctcggagtggacagcgtgttcggggtgatctat
cccccgcaggtggccatggtgggactcggcagggtcatggagcaggcgtgggcccacgac
gggatgttgggcgtacgcccggtggtcaccgcaacgctctcggcggaccaccgggtcagc
gacggcctgcgcggcgcccgctacctggcacaactggacgagctgctgcagaaaccggag
gagctgtga

DBGET integrated database retrieval system