KEGG   Pseudarthrobacter phenanthrenivorans: Asphe3_03360Help
Entry
Asphe3_03360      CDS       T01435                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
apn  Pseudarthrobacter phenanthrenivorans
Pathway
apn00040  Pentose and glucuronate interconversions
apn00053  Ascorbate and aldarate metabolism
apn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Asphe3_03360
   00053 Ascorbate and aldarate metabolism
    Asphe3_03360
Enzymes [BR:apn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     Asphe3_03360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADX71552
UniProt: F0M8K9
Position
complement(356407..358020)
Genome map
AA seq 537 aa AA seqDB search
MTLTGHSLIAGQTVVGEGKTAFGFNPATNEQLDPAYSLITADQLKAATAAAAEAYPSFST
LDPETHAAFLEAIADNIEAIGEELIIRAGQETGLPAARLQGERARTTGQLRLFADVVRQG
DFRGVRIDPAIPDRSPLPRADIRQRQIPLGPVAVFGASNFPFAFSTAGGDTASALAAGCP
VIFKAHNAHPGTGELVGHAVVKAVKDSGLHPGVFSLVYGPGASIGQALVADPHIKAVGFT
GSQAAGIALMKTAAARREPIPVYAEMSSLNPVFVFEGALNGSAEHIDALAQQYVTAVTGS
SGQLCTSPGLLFAPAGEAGDKLAAAVARAVSACSGQTMLTEGIAGSWNAGTETLGSAAGV
DLIGKGLEGATRNAPAPTIFGTQVRDFVTNHVLHEEIFGAASLVIRYNTTEELLDAAARI
EGQLTASLHLAEEDYPTAAPLIPVLEQKVGRIIVNGWPTGVEVGHAMVHGGPFPATSDSR
STSVGTLAINRFLRPVAYQNIPQELLPQPLQDTNPWHLNRRINGDVVPAAQKAEVGA
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
gtgaccctcaccggacactccctgatcgccggacagaccgtcgtcggcgaaggcaaaacg
gccttcggcttcaacccggccaccaatgaacagctggaccccgcctactcgctgatcaca
gcggaccagttgaaggccgccacggccgcggcggctgaggcctacccgtcgttcagcacg
ctggatccggaaacccacgccgctttcctggaagccatcgcggacaacatcgaggccatc
ggcgaggaactcatcatccgcgccggccaggagaccgggctgcctgcggcaaggctgcag
ggcgaacgggcccgcaccaccgggcagctgcggctcttcgccgatgtggtccgccagggc
gacttccgcggcgtccgcatcgacccggccatcccggaccgttcccccctgccccgcgcg
gacatccgccagcgccagatcccgctcggtcccgtggccgtgttcggtgccagcaacttc
ccgttcgcgttctcaacggcgggcggggacaccgcctcagccctcgccgcaggctgcccg
gtcattttcaaggcacacaacgcccaccccggcaccggggaactggtggggcacgcggtg
gtcaaggccgtgaaggactccggcctgcacccaggcgtgttctccctggtctacggcccc
ggtgcgagcatcggccaggctctcgtggcggacccgcacatcaaggccgtgggcttcacc
ggttcccaggctgccggcatcgccctcatgaagaccgccgccgcccggcgcgaacccatt
ccggtctatgccgaaatgtcctccctgaatcctgtcttcgtcttcgaaggcgccctgaac
ggctccgccgaacacatcgacgcactcgcgcagcagtacgtcaccgctgtcaccggcagc
tccggccagctctgcacctcccccggcctcctcttcgcccccgccggcgaggcaggggac
aaactcgcagccgccgtcgcacgcgctgtttccgcctgctccgggcagaccatgcttacc
gaaggaatcgccggatcctggaacgccggaactgaaacactgggcagcgcagcaggcgtt
gacctgatcggaaaaggcctggaaggcgccacccggaacgctccggcccccaccatcttc
ggcacccaggtccgcgacttcgtcaccaaccacgtcctgcatgaggaaatcttcggcgcc
gcctccctggtgatccgctacaacaccaccgaagagctcctcgacgccgcggcacggatc
gaaggccagctcaccgcctcgctgcacctggccgaagaggattatccgacggcggcaccc
ctgatcccggtcctggagcagaaagtgggccgcatcatcgtcaacggctggcccaccggc
gtcgaagtaggccacgccatggtccacggcggccccttccccgccacctccgattcccgc
agcacctcggtgggtaccctggcgatcaaccggttcctccggcctgtcgcctaccagaac
atcccccaggagctcctcccccagccgctccaggacaccaacccctggcacctcaaccgc
cggatcaacggcgacgtggttcccgctgcacagaaagcagaggtcggcgcatga

DBGET integrated database retrieval system