KEGG   Pseudarthrobacter phenanthrenivorans: Asphe3_10360Help
Entry
Asphe3_10360      CDS       T01435                                 

Definition
(GenBank) theronine dehydrogenase-like Zn-dependent dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
apn  Pseudarthrobacter phenanthrenivorans
Pathway
apn00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:apn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Asphe3_10360
Enzymes [BR:apn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Asphe3_10360
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Asphe3_10360
    1.1.1.-  
     Asphe3_10360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C NAD_binding_3 2-Hacid_dh_C FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ADX72220
UniProt: F0M3K1
Position
1090069..1091124
Genome map
AA seq 351 aa AA seqDB search
MKAARFHARKDIRIEDIPEPDLLAETVKIDVAWCGICGTDLHEYLEGPIFVPAPGHPHPL
SHEEAPVTLGHEFSGTVSEVGEGVTGLAKGDNVVVEPYFVCDECDSCNAGNYHLCRQMGF
IGLSGGGGGLSEKIVVDQRWVHPIGDIPLDEAALIEPLSVAHHAVARSGVKAGDTALVGG
SGPIGLLTAAVLKGMGVTTIISELTQARKEKATSSGVADHVLDPSKEDVPARVRELTGGT
GADVAFECAGVNAVLDTMLDAVRPGAVVVNVSIWGAPATVDMQKLVLKEIDLRGTIAYVR
DHPAVIKMVQEGKVDLKPFITGRIALEDLVEQGFDTLINHKDTAVKVLVHP
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcacgattccacgcccgcaaggacatccgtatcgaggacatcccggagccg
gacctcctcgctgagaccgtcaagatcgacgtcgcgtggtgcggcatctgcggcaccgac
ctgcacgagtacctggagggccccatcttcgtcccggcgccaggccacccccacccgctg
tcccacgaggaagctccggtgacgctgggacacgaattctccgggactgtctctgaggtc
ggcgaaggggtgacgggcctcgcgaagggggacaacgtcgtcgtcgagccctattttgtc
tgcgacgaatgcgattcctgcaacgcaggcaactaccacctgtgccggcagatgggcttc
atcgggctgtcgggcggcgggggagggctgagcgagaagatcgtggtggaccagcggtgg
gtgcaccccatcggggacattccgctggatgaggctgccctgatcgagccgctgtccgtg
gctcaccacgcggtggcgcgcagtggcgtgaaggccggcgacaccgcactggtgggcggt
tccgggccgatcgggctgctcaccgcggcggtcctgaagggcatgggggtgaccacgatc
atcagcgaactcacccaggcgcgcaaggagaaagccacgtccagcggcgtggcggaccat
gtcctggatccgagcaaagaggacgtcccggcgcgggtgcgcgagctcaccggcgggacg
ggggccgacgtcgcgttcgaatgcgccggcgtgaacgcggtgctggacaccatgctcgac
gccgtccggcccggcgccgtggtggtcaacgtgtccatctggggcgcgcccgccaccgtg
gacatgcagaagctggtcctcaaggagatcgacctgcgcggcaccatcgcctacgtccgg
gaccaccccgccgtgatcaagatggtgcaggagggcaaggtggacctcaagccgttcatc
accggccggatcgcgctggaggacctggtggagcagggcttcgacaccctgatcaaccac
aaggacaccgcggtaaaggtgctggtgcacccgtag

DBGET integrated database retrieval system