KEGG   Pseudarthrobacter phenanthrenivorans: Asphe3_15300Help
Entry
Asphe3_15300      CDS       T01435                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
apn  Pseudarthrobacter phenanthrenivorans
Pathway
apn00010  Glycolysis / Gluconeogenesis
apn00052  Galactose metabolism
apn00500  Starch and sucrose metabolism
apn00520  Amino sugar and nucleotide sugar metabolism
apn00521  Streptomycin biosynthesis
apn01100  Metabolic pathways
apn01110  Biosynthesis of secondary metabolites
apn01120  Microbial metabolism in diverse environments
apn01130  Biosynthesis of antibiotics
apn01200  Carbon metabolism
Module
apn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
apn_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Asphe3_15300
   00052 Galactose metabolism
    Asphe3_15300
   00500 Starch and sucrose metabolism
    Asphe3_15300
   00520 Amino sugar and nucleotide sugar metabolism
    Asphe3_15300
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Asphe3_15300
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Asphe3_15300
Enzymes [BR:apn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Asphe3_15300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FGGY_N DEDD_Tnp_IS110 CO_deh_flav_C Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: ADX72699
UniProt: F0M8W4
Position
1634222..1635232
Genome map
AA seq 336 aa AA seqDB search
MGPRRGEGFRQHLRLGRKGLAIGIDIGGTKVAAGVVDADGRILSEARRTTPGRDPRAVEQ
VIVELVEELGRGHRIWSVGIGAAGWMDLDGGTVLFSPHLAWRNEPLRANLQQLLRRPVLL
ANDADAAAWAEWRFGAGQGEDRLVCITLGTGIGGAMVMDGRVERGRFGVAGEFGHQIIMP
GGHRCECGNRGCWEQYASGNALGREARILARANSPVAQDLLAAVGGRADAITGAIVTELA
LAGDPASRELLEEVGEWLGLGLANLAAALDPGLFVIGGGLCSAGDLLVEPARKAFARNLT
GRGFRPAAGIELAALGPNAGLIGAADLSRVSSRTRR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgggtccgcggcgcggcgagggcttccggcaacacctgcgccttgggcgtaaggggctg
gccattggcatcgacatcgggggcaccaaggtagccgcgggtgtggtggatgccgatggc
aggatcctcagcgaggcgcggcgaaccacgccgggcagggatccccgggccgtggagcag
gtcatcgttgagctggtggaggaactgggcaggggccaccggatctggtccgtagggatt
ggcgcggccggctggatggatctcgacggcggcacagtgctgttcagcccacacctcgcc
tggcgtaatgaaccgctccgggccaacctgcagcaactcctccgccggccggtgctcctg
gccaacgacgctgacgccgccgcctgggccgagtggcgctttggcgcgggccagggcgaa
gaccgcttggtttgtatcacgttgggtaccggtattggcggagccatggtgatggacggc
agggtagaacggggccgcttcggcgtggccggcgagttcgggcaccagatcatcatgccc
ggcgggcaccgctgtgaatgcggcaaccggggctgctgggagcagtacgcatctgggaat
gctttgggccgcgaggcaaggatcctggcgcgggccaactctccggtggcgcaggacctg
cttgcggccgtgggcggacgggcggacgccatcaccggtgccattgtgacggaactggcg
cttgccggcgatccggcttcacgcgaactgctcgaggaagtgggggagtggctgggcctt
ggcctggcaaatcttgccgccgcgctggatccggggctattcgttattggcggcgggttg
tgctcagccggtgacctgttggtggagcctgccaggaaggccttcgcacgcaacctgaca
ggccgcgggttccgtcccgcagcggggattgaactggccgcgctcgggcccaatgcgggg
cttatcggcgccgcagacctctccagggtaagcagccggacgcgtcgctga

DBGET integrated database retrieval system