KEGG   Pseudarthrobacter phenanthrenivorans: Asphe3_15660Help
Entry
Asphe3_15660      CDS       T01435                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
apn  Pseudarthrobacter phenanthrenivorans
Pathway
apn00340  Histidine metabolism
apn01100  Metabolic pathways
apn01110  Biosynthesis of secondary metabolites
apn01230  Biosynthesis of amino acids
Module
apn_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Asphe3_15660
Enzymes [BR:apn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Asphe3_15660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh Gln-synt_N_2
Motif
Other DBs
NCBI-ProteinID: ADX72735
UniProt: F0M9L5
Position
1674139..1675506
Genome map
AA seq 455 aa AA seqDB search
MTNSSENTASPAAAVVDFRTVDLRGRSLTLAGLRAAVPRAQGHTVADAEEKVLDIISAVR
QRGFEALGELALRFDGVQQEHPLVPQDALSAALDGLDPSVRRALEESISRARRFADGQRP
RNIDVELGDGALVSQNWVPVARVGLYVPGGLAVYPSSVIMNVVPALAAGVQSIALASPPQ
KEFGGLPHPTILAAAALLGITEVYAIGGAQAIAAFAYGVAASDAGPALEPVDVVTGPGNI
FVATAKRLVKGVVGIDSEAGTTEIAILADSTARPRLVAADLISQAEHDPKAASVLITDSE
ELAAAVRTELEQQAAATKHGSRVREALSGPQSGVVLVDNLEQGIAACDAYAAEHLEIMTR
DAAGVAARIRNAGAIFVGDYSPVSLGDYCAGSNHVLPTSGTAAFSSGLNVTTFLRAIQVV
NYSREALAEVSTHIVSLSGAEDLPAHGDAVTARFS
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaattcttcggagaataccgccagcccagccgccgccgtcgtggacttccgcacc
gttgacctgcgcgggcggagcctgacgctcgcgggcctgcgcgcggccgtgccccgcgcc
cagggccacaccgtggcggacgccgaggagaaggtgctggacatcatttccgccgtccgg
caacgcggattcgaggcgctgggcgaactggccctccgcttcgacggcgtccagcaggag
catccgctggttccgcaggacgccctctccgccgcgctggacgggctggacccgtccgtc
cgccgtgcgctggaggaatcgatcagccgcgcccggcgttttgcggacggccagcgcccg
cgcaatatcgacgtcgagctcggtgacggtgccctggtgagccagaactgggtgccggtg
gcgcgcgttggcctctacgttcctggcggcctggccgtatacccgtcctccgtgatcatg
aacgtggttccggcgctggctgccggtgtgcagtccattgcgctggcctcaccgccgcag
aaggagttcggcgggctgccccaccccaccatccttgctgccgcagccttgctgggcatc
acggaggtctatgccatcggcggcgcccaggcgatcgccgcgttcgcctacggcgtggct
gcatcagacgccggcccggccctggagccggtggatgtggtgacaggaccaggcaacatt
ttcgtggctacggccaagcggctggtgaagggcgtggtgggaatcgattccgaggccggc
accacggagatcgcgattctggccgactccacagcccggccccgccttgttgcggcggac
ctcatcagccaggccgagcacgatcccaaggccgcctcggtgctcattaccgattccgag
gagctggcggccgctgtacggactgaactggagcagcaggcggcggccacgaaacacggg
tcgcgcgtccgcgaagccctgtccggtccgcagtccggagttgtgctggtggacaacctg
gagcagggcatcgccgcctgcgacgcctacgctgccgagcaccttgagatcatgacccgg
gacgctgccggtgttgcagcccggatccggaatgccggcgccatcttcgtgggggactac
agccctgtgagcctgggcgattactgcgccggctccaaccacgtgctgcccaccagcggc
acggcagctttttcctcgggcctgaatgtgaccacgttcctgcgggccatccaggtagtt
aactacagccgggaggcgctggccgaggtcagcacgcacattgtgagcttgtccggcgcg
gaggaccttccggcgcacggtgatgccgtgactgcccggttctcctga

DBGET integrated database retrieval system