KEGG   Pseudarthrobacter phenanthrenivorans: Asphe3_16310Help
Entry
Asphe3_16310      CDS       T01435                                 

Definition
(GenBank) L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
apn  Pseudarthrobacter phenanthrenivorans
Pathway
apn00260  Glycine, serine and threonine metabolism
apn01100  Metabolic pathways
apn01110  Biosynthesis of secondary metabolites
apn01120  Microbial metabolism in diverse environments
apn01130  Biosynthesis of antibiotics
apn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:apn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Asphe3_16310
Enzymes [BR:apn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Asphe3_16310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ADX72800
UniProt: F0M9T0
Position
complement(1755313..1756434)
Genome map
AA seq 373 aa AA seqDB search
MSKAMTTTAETAAGIRLHDPNVRGFASDNYSGVHPEVLAALAAANDGHQVSYGEDDYTAR
LQELMEDHFGTGIECFPVFNGTGANVLSLQSLLPRWGAVVCASTAHINMDENGAPERVGG
IKLLQVPTPDGKLTPELIDREAWGWGDEHRAQPLAVSITQTTELGTCYTAEEVRAIADHV
HAKGMKLHMDGARLANAAAHLQVPLRAFTRDAGVDILSFGGTKNGLLFGEVVVALNPEAA
HGLIYLRKMNMQLASKMRFMSAQFIALLEGDLWLRSAAHANAMAARLRAAVDIIDGVQPT
QKTESNGVFAILPEGVADRLRASFRFYDWNEATREVRWMCSFDTTEEDVDSFVAALRDEL
RRHPDGAAGGQSA
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaaagccatgacaacaaccgctgaaactgcggccggaatccgcctccacgatccc
aacgtccggggcttcgcctcggacaactactccggcgtgcatccggaggtcctcgccgcc
ctcgccgcagccaacgacggccaccaggtctcctatggcgaggacgactacacagccagg
ctgcaggaactgatggaggaccatttcggaaccggcatcgagtgctttcccgtcttcaac
ggcaccggcgccaatgtcctgtcactgcagtccctgctgccacggtggggagcagtggtg
tgtgcctccaccgcccacatcaacatggacgaaaacggcgcccccgagcgcgtcggcggc
atcaagctcctccaggtgccgacgccggacggcaagctcacgcccgaactgatcgatcgc
gaggcgtggggctggggcgacgagcaccgggcccagccgctggctgtttccatcacccaa
acaaccgagcttggcacctgctataccgccgaggaagttcgtgccatcgctgaccacgtc
catgccaaggggatgaagctccacatggacggcgcccggctggccaacgccgccgcccac
ctgcaggtcccgctgcgcgcgttcacccgggacgccggtgtggacatcctgtccttcggc
ggcaccaagaacggcctgctcttcggcgaagtggtggtggccctgaacccggaagccgcc
cacgggctcatttacctgcgcaagatgaacatgcagctggcatcgaagatgcgcttcatg
tccgcccagttcatcgcgctccttgaaggcgacctgtggctgcggtccgccgcgcatgcc
aatgccatggccgcccggctccgtgccgccgtcgacatcatcgacggggtgcagcccacc
cagaagactgaatccaacggcgtgttcgctatccttcccgaaggcgtggcggacaggctg
cgggcctcgttccggttctacgactggaacgaggccaccagggaggtgcgctggatgtgc
tccttcgacaccacggaagaggatgtggattcctttgttgccgcactccgcgacgaactc
cggaggcacccggatggcgcagccggcggacagtccgcctag

DBGET integrated database retrieval system