KEGG   Pseudarthrobacter phenanthrenivorans: Asphe3_16670Help
Entry
Asphe3_16670      CDS       T01435                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
apn  Pseudarthrobacter phenanthrenivorans
Pathway
apn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
apn01100  Metabolic pathways
apn01110  Biosynthesis of secondary metabolites
apn01130  Biosynthesis of antibiotics
apn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Asphe3_16670
Enzymes [BR:apn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Asphe3_16670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth QRPTase_C FMN_dh DUF1863
Motif
Other DBs
NCBI-ProteinID: ADX72828
UniProt: F0MAG0
Position
1781053..1781874
Genome map
AA seq 273 aa AA seqDB search
MPTVLDDINAGVREDMEARKRLVSLAELKDRAQAAPPAHDAWAVLGGPSASRDELKVIAE
IKRRSPSKGDLAAIGDPASLARQYADGGASVISVLTEQRRFNGSLADLDAVRAAVDTPLL
RKDFTLDEYQIWEARAHGADLILLIVAALSDAQLAEFSALSHELGMNVLVETHTEEEIER
AIAAEARIIGVNVRNLKTLDVDRSVFASLAGKIPAGALVVAESGVRDVDDVRHYAASGAN
AVLVGEALVSHSTPRDRIAEFKAAGAAAIAARA
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgccgactgttctcgatgacatcaacgccggtgtcagggaggatatggaggccaggaag
cggctcgtttcgctggcagaactgaaggaccgggcccaggccgcgccacctgcccatgac
gcctgggcagttctgggaggtccctcggcatcacgcgatgagctcaaagtcatcgcggag
atcaagcgccgcagcccctccaagggggaccttgccgccattggtgatcccgcatccctt
gccaggcagtatgccgacggcggtgcctccgtcatcagcgtcctcaccgaacagcgccgc
ttcaacgggtccctcgccgacctcgatgccgtgcgtgccgccgtcgacaccccgctcctg
cgcaaggacttcacgctggacgagtaccagatctgggaggcccgtgcccacggcgccgac
ctgatcctgctgatcgtcgccgcgctctccgacgcccagctcgccgaattcagcgccctc
agccacgaactcggcatgaacgtcctcgtggagacgcacacggaagaggaaatcgaacgg
gccatcgcggctgaggcgcgcatcatcggcgtcaacgtgcgcaacctgaagacgctcgac
gtcgaccgttcagttttcgcctccctggcagggaagatcccggccggggcacttgtggta
gccgaatcgggcgtgcgggacgttgacgacgtcaggcactacgccgccagcggcgcaaac
gccgtgctggtaggcgaagcgctggtcagccattcgacgccccgcgaccggatcgccgaa
ttcaaagccgccggcgctgccgccatcgcggcacgggcctga

DBGET integrated database retrieval system