KEGG   Pseudarthrobacter phenanthrenivorans: Asphe3_18330Help
Entry
Asphe3_18330      CDS       T01435                                 

Definition
(GenBank) methyltransferase, cyclopropane fatty acid synthase
  KO
K05928  tocopherol O-methyltransferase [EC:2.1.1.95]
Organism
apn  Pseudarthrobacter phenanthrenivorans
Pathway
apn00130  Ubiquinone and other terpenoid-quinone biosynthesis
apn01100  Metabolic pathways
apn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Asphe3_18330
Enzymes [BR:apn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.95  tocopherol O-methyltransferase
     Asphe3_18330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CMAS Methyltransf_11 Methyltransf_25 Methyltransf_23 Methyltransf_12 Methyltransf_31 DOT1 MTS MetW Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: ADX72989
UniProt: F0MBQ6
Position
1975210..1976106
Genome map
AA seq 298 aa AA seqDB search
MIVPNISQSTAAVADHYDELDPVYRRVWGDHVHHGLWVTGRETPGEAVEALVDTVGERLR
LTPGETCVDIGCGYGSTARRLASTRGVRVTGFTLSAEQAHFAAAHSVPDVDIRVRDWLDN
DVADASVDAAWAIESSEHMVDKPGFFAEAHRVLLPGGSFVICAWLAESGAGGWKVRHLLE
PICREGRLPSMGTREEYEAMATAAGFVVTGYEDVSRRVARTWMICAGRLVKALFTDREMR
RLALRARNRVFVLSIPRLILAYRTGAMHYGIFTLTKASGSGRVSNQDRAEKSGELHSG
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgtccccaacatttcccagagcaccgctgcggtcgcggatcactacgacgagctc
gatccggtttatcggcgggtgtggggtgatcatgtccatcacgggttatgggtgacgggt
cgtgagacgcccggggaggccgtcgaggcactggtcgataccgtcggggagaggttgcgc
cttacgcctggggagacgtgcgtggacatcggctgcggctatggctcgaccgcgaggcgg
ctcgcgtcgacacgcggggttcgcgtcaccggcttcaccctttccgctgagcaggcccac
ttcgcggccgcgcattccgtaccggacgttgacatccgggtgcgcgactggcttgacaac
gacgtggctgatgcctcggtcgatgccgcgtgggcgatcgagtcgagtgagcacatggtg
gacaagcccgggtttttcgccgaggcgcaccgcgtgctgttgcccggcggcagcttcgtc
atctgcgcgtggctcgccgagagcggtgctggcgggtggaaggtccgccacctgcttgag
ccgatctgccgggaagggcgcctgccctcgatgggcacccgcgaggagtacgaggcgatg
gcaacagccgcgggcttcgtggtcaccggctacgaggatgtcagccgccgcgtcgcccgc
acctggatgatctgcgccggcaggctcgtgaaggccttgttcaccgaccgtgagatgcgc
cgcctggccctgcgcgcgcgcaaccgtgtcttcgtcctcagcattccgcgcctgatcctg
gcctaccgcaccggtgcgatgcactacgggatatttacgctcacgaaggcgagtgggagt
gggcgggtcagcaaccaggaccgggctgaaaagtcgggtgaattgcattccgggtaa

DBGET integrated database retrieval system