KEGG   Pseudarthrobacter phenanthrenivorans: Asphe3_20930Help
Entry
Asphe3_20930      CDS       T01435                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
apn  Pseudarthrobacter phenanthrenivorans
Pathway
apn00010  Glycolysis / Gluconeogenesis
apn00071  Fatty acid degradation
apn00350  Tyrosine metabolism
apn00625  Chloroalkane and chloroalkene degradation
apn00626  Naphthalene degradation
apn01100  Metabolic pathways
apn01110  Biosynthesis of secondary metabolites
apn01120  Microbial metabolism in diverse environments
apn01130  Biosynthesis of antibiotics
apn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Asphe3_20930
  Lipid metabolism
   00071 Fatty acid degradation
    Asphe3_20930
  Amino acid metabolism
   00350 Tyrosine metabolism
    Asphe3_20930
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Asphe3_20930
   00626 Naphthalene degradation
    Asphe3_20930
Enzymes [BR:apn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Asphe3_20930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ADX73247
UniProt: F0M326
Position
2244742..2245740
Genome map
AA seq 332 aa AA seqDB search
MGRPGPISTHPLVTGTREDPRPGAKELLVEVSVCGICRTDLHLAEGDLEPRRPGVVPGHE
AVGVVVECGPGTSRFMPGDRVGVAWLGGVCGTCPYCRRGDENLCSAPVFTGWDRDGGYAQ
KLVVSQDFAYLIPDVFTDEQAAPLLCSGIIGYRALKRAGIVPGGRLGIYGFGSSAHLTAQ
MAMHQGMSVYVMTRSESARALARELGVEYAGGARDKPPQPLDAAILFAPVGDLVPVALQA
LDRGGTLAIAGIHLSDIPSLNYQAHLFHERQVRSVTANTRADGQEFLALAAEIPLAPTTT
TYPFDAAGRALEDLAADRITGSAVLRVRPEGG
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
gtgggccggcccggtcccatatctacgcatcccctggtcacgggtactcgcgaggacccc
aggcccggcgccaaggaactcctggtcgaggtcagcgtctgcggcatctgccggactgac
ctccacttggctgagggcgacctggagccccgccgcccgggagtggtgccgggacacgag
gccgtgggggttgtggttgaatgcggccctggcacgtcccggttcatgcccggggacagg
gtgggcgtggcctggctgggaggcgtctgcgggacctgcccttactgccgccgcggcgac
gaaaacctgtgctccgcgccggtcttcacaggctgggacagggacggcggctacgcccag
aaactcgtagtctcccaggactttgcctacctcattcccgacgtgttcacagatgaacag
gcggcgccgctgctgtgttccggaattatcggctaccgtgccttgaaacgcgcgggcatc
gtgcccggagggcgcctgggcatctacggcttcggcagctcagcgcatctgaccgcgcag
atggcgatgcaccagggcatgtctgtctatgtcatgacccgctccgagagtgcccgtgcc
ctggcccgggaactcggcgtggagtatgccggcggcgcccgcgacaagccaccgcagccg
ctggatgcggccatcctttttgccccggtgggtgacctggtgcctgttgccctccaggcc
cttgatcgtggcggcaccctggcgattgccggcatacacctgagcgacattccctccctg
aactatcaggcacacctgttccacgagcgccaggtgcggagtgtgacagccaatacccgt
gcggacgggcaggaattccttgcgctggcagccgaaatcccgctggcgccaaccaccacc
acgtatccgttcgacgccgccgggagggcacttgaggaccttgcggcggacaggatcacc
ggatccgccgtcctgcgggtccgtcccgaaggcggctaa

DBGET integrated database retrieval system