KEGG   Pseudarthrobacter phenanthrenivorans: Asphe3_27450Help
Entry
Asphe3_27450      CDS       T01435                                 

Definition
(GenBank) Formate-tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
apn  Pseudarthrobacter phenanthrenivorans
Pathway
apn00670  One carbon pool by folate
apn01100  Metabolic pathways
apn01120  Microbial metabolism in diverse environments
apn01200  Carbon metabolism
Module
apn_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:apn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Asphe3_27450
Enzymes [BR:apn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     Asphe3_27450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA AAA_31
Motif
Other DBs
NCBI-ProteinID: ADX73864
UniProt: F0M964
Position
2929688..2931364
Genome map
AA seq 558 aa AA seqDB search
MPSTPSDLQIARTARIRPIEEVAAAAGINADALEQYGRFKAKIDPARLNAPAPHGKVVLV
SAMSPTPAGEGKSTTTVGLADSLARAGHKVMIALREPSLGPVLGMKGGATGGGYSQVLPM
DEINLHFTGDFHAITSANNALMALVDNHIYQGNALNIDPRRMTFKRVLDMNDRALREVVI
GLGGPTQGVPRQDGFDITVASEIMAVFCLATDLADLRSRLGRITFGYTFDRSPVTVADLG
VQGALTLLLKEAIKPNLVQTIAGTPALVHGGPFANIAHGCNSLIATQTARRLANIVVTEA
GFGADLGAEKFMDIKARVGALAPSAVVVVATVRALKMQGGVAKDQLTAPNLAALEAGVAN
LRRHVRNVEKFGVPSVVAINRFAFDSAEELDWLLAWCAAEGVPAAVADVWGHGGGGDGGD
ELAALVAQAAAKPNSFRHLYPLELPVEDKIRTIAQEIYGADGVDFSVPALKRLADIERNG
WGGLPVCMAKTQYSFTDDASRLGAPKGFTIHVRDLLPKTGAGFIVALTGAVMTMPGLPAA
PAAMRMDVDAEGNPVGLA
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgccttccaccccaagtgacctgcagatcgccaggacggcacggatccggcccatcgag
gaagtcgccgcggcggcgggcatcaatgctgatgcgctggaacagtacggacggttcaag
gcgaaaatcgaccccgcacgccttaacgctcctgccccgcacgggaaggtggtgctggtc
tctgcgatgtcccccactcccgccggtgaggggaagtccaccaccaccgtggggctggcg
gattcactggcgcgggccggccacaaggtaatgatcgccctgcgcgagccttcactgggc
ccggtcctgggcatgaagggcggcgccaccggcggcggttactctcaggtgctgccgatg
gacgaaatcaacctccacttcaccggcgacttccacgccatcacgtcagccaacaatgcg
ctgatggcgctggtggacaaccacatctaccagggcaacgctttgaatattgatccccgc
cggatgacgttcaagcgggtgctggacatgaacgacagggccctgcgggaagtggttatc
gggcttggcgggcctacccagggagttccgcgccaggacggtttcgacattaccgtagcg
tccgagatcatggcggtgttctgcctggccactgatttggccgacctccgctcccggctg
ggccgcatcacgttcggctacaccttcgaccgctcccccgtcacggttgcggacctgggc
gtgcagggcgcgctgacgctcctgctgaaggaggccatcaagcccaacctggtgcagacc
atcgccggcacccccgcccttgtccacggcggtcccttcgccaatatcgcccacggctgc
aactcgttgatcgccacacagacggcgcggcggctggcgaacatcgtggtcacggaggcg
ggcttcggcgccgacctgggcgccgaaaagttcatggacatcaaggcacgcgtcggggcg
ctggcgccctctgcggtggtggtggtggcaacagtgcgggcactgaaaatgcagggcggg
gtggccaaggaccagctcacggcgccgaacctcgccgccctcgaagccggcgtggccaac
ctgcgcaggcacgtccggaacgtggagaagttcggggtgccatccgtcgtggccatcaac
aggttcgccttcgactcagccgaggaactcgactggctgctggcgtggtgcgccgcggag
ggcgttccggccgccgtcgccgatgtctgggggcacgggggcggtggcgacggcggggat
gaactcgccgccctcgtggcgcaggcggccgccaagccgaacagcttccggcacctctac
ccgctggaactgccggtggaggacaagatccggaccatcgcgcaggagatctacggagcg
gacggcgtggacttctcagttcctgccctgaagcgactggcggacatcgagcggaacggg
tggggcgggctgccggtatgcatggccaagacccagtactcattcacggacgacgcctca
cgcctcggggcaccgaagggcttcaccatccatgtgcgggacctcctgcccaagaccggg
gccggcttcatcgtggcactgaccggagcggtaatgacgatgcccggcctgcccgcagcc
ccggccgccatgcggatggacgtggacgccgaaggcaaccctgtgggcctcgcctaa

DBGET integrated database retrieval system