KEGG   Pseudarthrobacter phenanthrenivorans: Asphe3_30800Help
Entry
Asphe3_30800      CDS       T01435                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
apn  Pseudarthrobacter phenanthrenivorans
Pathway
apn00620  Pyruvate metabolism
apn00630  Glyoxylate and dicarboxylate metabolism
apn01100  Metabolic pathways
apn01110  Biosynthesis of secondary metabolites
apn01120  Microbial metabolism in diverse environments
apn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Asphe3_30800
   00630 Glyoxylate and dicarboxylate metabolism
    Asphe3_30800
Enzymes [BR:apn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Asphe3_30800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ADX74190
UniProt: F0M1J4
Position
3276110..3277726
Genome map
AA seq 538 aa AA seqDB search
MPLTSPAHLPFHRAAEILTPEALEFLAELHRRFASERDTRLAARQERRAEAGKTGTLDFL
PETAAVREGDWTVAPVPPALQDRRVEITGPCSPAKMAINALNSGAKVWLADLEDASCPTW
FNVIDGQLSLYDATRGTLAYTSPEGKTYALRTDAPTAVVIMRPRGWHMDERNLEFDGKPA
IGALVDFGLHFFHNAKRLLDNGHGPYYYLPKMESHLEARLWNEIFVFAQDALGIPQGTIR
ATVLVETIPAAFEMDEILYELRDHASGLNAGRWDYLFSIIKYFRDSGSKFTLPDRAAVSM
TVPFMRAYTELLVKTCHQRGAFAMGGMAAVIPNRRQPEVTEEAFAKVRADKTREANDGFD
GSWVAHPDLVSICMEVFDGVLGDASNQVQRTRPEVHVTAEQLLDIESAPGEATEAGLRGN
LYVSVAYTAVWLSGNGAVAIHNLMEDAATAEISRSQVWQQIRNEVVYADTGNTATRELVE
RLLAEETEKLRNEVGEELFSRYYEPASRIISEICLSEDYTDFLTTPAYEVLESEMAAR
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgacctcacccgcccacttgcccttccaccgcgcggcggaaatcctgacgccg
gaagcccttgagttcctggccgaactccacaggcgcttcgcctccgaacgggatacgcgt
cttgctgcgcgtcaggagcgccgcgcagaggccggaaagaccggcaccctggacttcctg
ccggagacagcagcagtgcgggagggtgactggaccgtcgccccggtgccgcccgccctt
caggaccgccgggtggaaatcaccggcccctgttctcctgcgaagatggcgatcaacgcc
cttaactcgggagccaaagtctggctggcagacctcgaggacgccagctgcccaacgtgg
ttcaacgtcatcgacggccagctctcgctgtacgacgccacacgcggaaccctggcctac
acctcgcccgagggcaaaacctacgccctgcgcaccgacgcgcccaccgccgtcgtcatc
atgcgcccccgcggttggcacatggatgagcggaacctggagttcgatggcaagcccgcc
atcggcgccctggtggactttggactacatttcttccacaacgcgaagcggctcctcgac
aacggccatggcccctattactacctgcccaagatggaaagccaccttgaagcccgtctg
tggaacgaaatcttcgttttcgcgcaggacgccctcggcatcccgcagggaactattcgg
gctaccgtgctcgtggaaaccattcccgccgcttttgagatggacgagatcctgtacgaa
ctccgcgaccacgcctccgggctgaacgccggacgttgggattacttgttcagcatcatt
aagtatttccgcgattccggttcaaagttcacgctgcctgaccgtgccgcggtatcgatg
acagttccctttatgcgcgcctacaccgaactgctggtcaagacctgccaccagcgcggc
gcgtttgccatgggcggcatggcagccgtcattccgaaccgccgccagccggaagtcacc
gaagaggcgttcgcaaaagtaagggctgacaagacccgcgaggccaacgacggattcgac
ggctcctgggttgcacacccggacctcgtttccatctgtatggaggtgttcgacggggtt
ctcggggacgcctcaaaccaagtgcagcgaacccgccccgaggtccacgtcaccgccgaa
cagttgctcgacatagagtcggcgcccggcgaggccaccgaggccggtctccgcggaaac
ctgtacgtttctgtcgcctacactgcagtatggctgtccgggaacggggccgtcgccatc
cacaacctcatggaagacgccgcaacggcggaaatctcacggtcgcaagtctggcagcag
atccgcaacgaagtggtttacgcggacaccgggaacacggcaacccgggaactggttgaa
cgtctgttggccgaggaaacggaaaagctccgcaacgaggtgggcgaggaactgttcagc
cggtactacgagccggcatcccgcatcatttcggagatctgtctctccgaggattacacc
gacttcctcaccacaccggcctacgaggtactggaatcagaaatggcggcccggtag

DBGET integrated database retrieval system