KEGG   Pseudarthrobacter phenanthrenivorans: Asphe3_37040Help
Entry
Asphe3_37040      CDS       T01435                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
apn  Pseudarthrobacter phenanthrenivorans
Pathway
apn00520  Amino sugar and nucleotide sugar metabolism
apn00550  Peptidoglycan biosynthesis
apn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Asphe3_37040
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Asphe3_37040
Enzymes [BR:apn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Asphe3_37040
Peptidoglycan biosynthesis and degradation proteins [BR:apn01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Asphe3_37040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase HTH_3 HTH_31 HTH_19 HTH_37 YdaS_antitoxin HTH_25 HTH_23 HTH_26 Pou MarR_2 Sigma70_r4 DUF4213
Motif
Other DBs
NCBI-ProteinID: ADX74802
UniProt: F0M7M3
Position
complement(3942829..3944352)
Genome map
AA seq 507 aa AA seqDB search
MTQETTEHVAAMLRDARGEKGWTQGQLAAELGTSQSAVARMEQGKQNLSLKMIQRLEAIF
GRSIVNVGKPQMTHLRVEGGRTLSGTVDVNSSKNAGVALLCASLINRGTTILRRLARIEE
VNRIVEVLSSIGVDCTWLNDTDLQLRRPAVLNLEAMDVDAARRTRSVIMLLGPLLDESAK
YRLPYAGGCDLGTRTVEPHMQALRQFGLSVEATAGFYTVQAPSADTRDRSFVLTERGDTV
TENAIMAAAHREGTTVIRNASPNYMVQDLCFYLQMLGVAIEGVGTTTLKITGRQSIDADI
EYFPSEDPIEAMSLITAGIVTNSEVTIRRVPIEFMEIELATLGQMGQELEISGEYMARNG
RTRLVDVTTKPSELRAPEDKIHPMPFPGLNIDNLPFFAVIAAKAHGQTMIHDWVYENRAI
YLTELNRLGAQVQLLDPHRIYVNGPTKWRAAEVGCPPALRPAACLLLAMLAARGVSELRN
IYVIERGYEDLAERLNTIGAKVEYFQD
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggaaaccactgagcacgtagccgccatgttgagggacgcccggggcgaaaag
ggttggacccagggccagctggccgcggagctgggaacaagccagagcgccgtcgcccgg
atggagcaggggaagcagaacctgagcctgaagatgatccagcgcctcgaagcgatcttc
ggccggagcatcgtgaacgtaggcaagccgcagatgacccatctgcgcgttgagggcgga
cgcaccctttccggtactgtggatgtcaacagcagcaagaacgccggcgtggcattgctg
tgcgccagcctgatcaaccggggaaccaccatccttcgccgcctggcacggatagaagag
gtgaaccggattgttgaggtgctctcctccattggagtggactgcacctggctcaacgac
accgacctgcagctgcggcgcccggccgtactcaacctggaggccatggacgtggatgct
gcccgccgcacccgcagcgtcatcatgctcctgggacccctgcttgatgagtcggccaag
taccggcttccctacgcgggcggctgcgaccttggcacccgcaccgtggagccgcacatg
caggcgctgcgccagttcgggctctcggtggaggcgacagccgggttctataccgtccag
gcgccttccgcagatacccgggaccgctcgttcgtcctgaccgaacggggcgataccgtt
acggagaacgccatcatggcagcggcccaccgtgaaggcacaactgtcatccgcaatgcc
agccccaactacatggtgcaggacctctgcttctacctgcagatgctcggagtggccatc
gagggagtgggcaccactaccttgaagatcaccggccgccagtcaattgatgcagacatc
gagtacttcccgtctgaggaccctatcgaggccatgagcctgatcaccgccggcattgtc
acgaactcggaagtgaccatccgtcgcgttcccatcgagttcatggaaatcgaactggcc
accctgggccagatgggccaggaactggaaatctccggtgaatacatggcccgcaacggc
cgcacccgcctggtggacgtcaccaccaaaccctcggaactgcgcgctccagaggacaag
atccatccgatgcccttccccgggctcaacatcgacaacctgccgttcttcgccgtcatc
gcagcgaaggcgcacggacagaccatgatccacgactgggtgtacgagaaccgcgccatc
tacctgacggagctgaaccggctgggggcgcaggttcagctcctggatccgcaccggatc
tatgtcaacggccccaccaaatggcgtgccgccgaggtgggctgcccgccggcacttcgt
ccggctgcgtgcctgctgctggcaatgctggctgcaaggggcgtgtccgagctaaggaac
atctacgtcatcgagcgcggctacgaggatctggcggagcgcctgaacaccatcggcgcg
aaggtggagtacttccaggactga

DBGET integrated database retrieval system