KEGG   Archaeoglobus profundus: Arcpr_0077Help
Entry
Arcpr_0077        CDS       T01152                                 

Definition
(GenBank) Protein of unknown function DUF207
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
apo  Archaeoglobus profundus
Brite
KEGG Orthology (KO) [BR:apo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:apo03016]
    Arcpr_0077
Enzymes [BR:apo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     Arcpr_0077
Transfer RNA biogenesis [BR:apo03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    Arcpr_0077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TYW3
Motif
Other DBs
NCBI-ProteinID: ADB57153
UniProt: D2RFS8
Position
complement(63235..63819)
Genome map
AA seq 194 aa AA seqDB search
MNWNEFKRSKLERLEKAKERKEVDEDIIPLLDLINSLDCFVTTSSCSGRIVVLDVPKIGD
KLNAKFLDKWHQPIDWKEIVKALEGSIRTAWLISDPPIIHVACRDLECAKALMKIANDSG
FRRCGLISLTRLVVEITSFERLEAPLAVDGRIVVSEEYIRLLADFANEKLLRGKEKLERF
KAKLLDHRSFLQAL
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
gtgaattggaatgagttcaagagatcaaaacttgagaggcttgagaaggctaaggagagg
aaggaagttgatgaagacataatccccttactggatttgatcaactcattggactgcttt
gtaactacgtcgagctgttccggtaggatagtggtcttagacgtgccgaagataggggat
aaattaaacgctaagtttttggataagtggcaccaacccattgattggaaagagattgtg
aaggcactcgagggatcgattagaacagcttggctaatctcagatccaccgattatacat
gtagcatgtagagacttggagtgtgctaaggctttgatgaagattgcgaatgattctggc
tttaggaggtgcggattaatttcgctcaccagacttgttgtcgagataacttccttcgaa
aggcttgaagctcctctggctgttgacggtagaattgttgtaagcgaagaatacattagg
cttttagcggattttgcaaacgagaaactcttaaggggtaaggaaaagctcgaacgcttt
aaggctaaacttttagaccatagatctttcttacaagctctctga

DBGET integrated database retrieval system