KEGG   Archaeoglobus profundus: Arcpr_0764Help
Entry
Arcpr_0764        CDS       T01152                                 

Definition
(GenBank) thiamine pyrophosphate protein domain protein TPP-binding protein
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
apo  Archaeoglobus profundus
Pathway
apo00010  Glycolysis / Gluconeogenesis
apo00020  Citrate cycle (TCA cycle)
apo00620  Pyruvate metabolism
apo00633  Nitrotoluene degradation
apo00640  Propanoate metabolism
apo00650  Butanoate metabolism
apo00680  Methane metabolism
apo00720  Carbon fixation pathways in prokaryotes
apo01100  Metabolic pathways
apo01120  Microbial metabolism in diverse environments
apo01130  Biosynthesis of antibiotics
apo01200  Carbon metabolism
Module
apo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:apo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arcpr_0764
   00020 Citrate cycle (TCA cycle)
    Arcpr_0764
   00620 Pyruvate metabolism
    Arcpr_0764
   00640 Propanoate metabolism
    Arcpr_0764
   00650 Butanoate metabolism
    Arcpr_0764
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Arcpr_0764
   00680 Methane metabolism
    Arcpr_0764
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Arcpr_0764
Enzymes [BR:apo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Arcpr_0764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C DXP_synthase_N BioW
Motif
Other DBs
NCBI-ProteinID: ADB57827
UniProt: D2RHQ2
Position
651355..652212
Genome map
AA seq 285 aa AA seqDB search
MKLADEIGCPLLPGNPSCQGCPHAIGLKALSVLKNPIVVVPAGCTTIIAGIHPKSSIDFP
LIHVPFASAPAVACGLSKAYDNVVVWMGDGAADIGFATLSGSAIRNDNIIVIVSDNEAYM
NTGIQASGTTFWKAKTTTSPTGKREEKKDLALIMLMHRVPYVATASIGYMRDFVQKVKKA
GSTKGFRFIHLHSPCPPGWRFDSSKTVEIARMAVKSGAWILWEYDGKFRLTGASRKYREK
DKRFPLADYIKAQGRFRGLSDDDVREIEIKIDNVWKVVEVLERTF
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaagttggcggatgaaataggttgtcctctgctgcccgggaatccgtcgtgccaagga
tgtccgcatgcaataggtctgaaggctttgagcgtcttgaaaaatccaattgtagtagtt
ccagctgggtgcacgacgataatagcagggatacatccaaaatcatccattgattttcct
ctaattcatgttccctttgcatccgctccagcagttgcatgcggtttgtccaaagcttac
gataacgtcgtagtttggatgggtgatggagctgcggatatagggtttgcaacactgagc
gggtctgcaataaggaatgacaacattatcgtaatcgtgagcgacaacgaggcttacatg
aatactggaattcaggcgagtggaactacattctggaaagctaagactacaacatcgcct
actggtaaaagagaggagaagaaagatttggctcttataatgctaatgcacagagttcct
tacgtagctaccgcaagtatcggttacatgcgcgacttcgttcagaaagttaaaaaggct
ggtagtaccaagggcttcaggttcattcatttacacagtccctgtcctccgggatggagg
ttcgattcatcaaaaactgttgagatcgcaaggatggcagttaaaagcggggcttggatt
ctgtgggagtacgatggaaaatttagattaactggagcgagcagaaagtacagagaaaag
gataagagatttcctctcgccgattatataaaagctcaaggtaggttcaggggtttaagc
gatgacgatgttagagagatagagataaaaattgataatgtttggaaagtagtcgaagtt
cttgaaagaactttttga

DBGET integrated database retrieval system