KEGG   Archaeoglobus profundus: Arcpr_0868Help
Entry
Arcpr_0868        CDS       T01152                                 

Definition
(GenBank) phosphatidylserine decarboxylase related protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
apo  Archaeoglobus profundus
Pathway
apo00564  Glycerophospholipid metabolism
apo01100  Metabolic pathways
apo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Arcpr_0868
Enzymes [BR:apo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     Arcpr_0868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase Peptidase_M23 PYNP_C DUF2118
Motif
Other DBs
NCBI-ProteinID: ADB57931
UniProt: D2RI06
Position
740352..740918
Genome map
AA seq 188 aa AA seqDB search
MIVKQGLKFIALEFLLLPLALLSPYLLIILLPIIALTILFFRDPDRGIEDGVVSPADGKI
DYVNDRRLEIFMSIFDCHVNRSPVDGIVRKIVYSKGSKLPAFMRHTNSERNEIYIETDHG
TFKVVQIAGFLARRIICFVKEGERVRKGEKIGMIVMGSRVVIEIPEGFKFVKRVGDRVKA
GETIAVKA
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgatcgttaagcagggcttaaagtttatcgcattggaatttctcttactaccgttagct
cttctcagcccttacttactgataatcctgctacctataatagcactaaccatcctattc
tttcgagatcctgacagaggtattgaggacggggtagtttcgccagccgatgggaagata
gactacgttaatgatagaagacttgaaattttcatgagtatctttgattgccatgtaaat
agaagtccggttgatgggattgttagaaaaattgtttacagtaagggatcaaagcttcca
gcttttatgaggcataccaattcagagagaaacgagatatacatagagaccgatcatgga
acatttaaagttgttcagattgccggttttcttgcaagaaggataatctgctttgtcaaa
gagggtgaaagggttagaaagggtgaaaaaataggtatgattgttatgggttcaagagtt
gtaattgaaatccctgaaggctttaagtttgttaagagagtcggtgatagagtaaaggct
ggtgagacgattgcagtcaaggcttag

DBGET integrated database retrieval system