KEGG   Archaeoglobus profundus: Arcpr_1059Help
Entry
Arcpr_1059        CDS       T01152                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
apo  Archaeoglobus profundus
Pathway
apo00010  Glycolysis / Gluconeogenesis
apo00020  Citrate cycle (TCA cycle)
apo00620  Pyruvate metabolism
apo00633  Nitrotoluene degradation
apo00640  Propanoate metabolism
apo00650  Butanoate metabolism
apo00680  Methane metabolism
apo00720  Carbon fixation pathways in prokaryotes
apo01100  Metabolic pathways
apo01120  Microbial metabolism in diverse environments
apo01130  Biosynthesis of antibiotics
apo01200  Carbon metabolism
Module
apo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:apo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arcpr_1059
   00020 Citrate cycle (TCA cycle)
    Arcpr_1059
   00620 Pyruvate metabolism
    Arcpr_1059
   00640 Propanoate metabolism
    Arcpr_1059
   00650 Butanoate metabolism
    Arcpr_1059
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Arcpr_1059
   00680 Methane metabolism
    Arcpr_1059
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Arcpr_1059
Enzymes [BR:apo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Arcpr_1059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II
Motif
Other DBs
NCBI-ProteinID: ADB58118
UniProt: D2RDC4
Position
896882..898024
Genome map
AA seq 380 aa AA seqDB search
MRKVVRGFYAVAHAVKLCRPNIICAYPITPQTEIVENLAEMYANGELENCKYITAESEFD
AASILVGASATGARTFTATCSQGLILMSEVLFNAAGMRLPIVMVNTNRAISAPLSIWNDL
QDSMVLRDAGIIQIYVEDNQEAHEMIPQAYKIAESVMFPTMVCMDGFKLTHAYEPIDLLD
QELVDSFLPPYDPPIKLSVDNPLTFGSYAPPHCYMEFRYRMHKDMVNAKKTIEKVFKEWA
EIRRDWGGLIEYKEGKTVLVAMGSLIGTIKEVAEENGLGYLKIRTYRPFPTEEIKEALKD
CENVIVFDRAVSFGYEGILTIDIRNALYGESPDVYSFIVGLGGRDVPKKLIEKCVSKVVN
KEIKPSYSFEGLKEFEEVLY
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaggtagttagaggattctacgccgttgcacatgctgtaaagctctgtagaccg
aatataatatgcgcttatccaataacacctcaaacggagatagtagagaatttggcagag
atgtatgcaaacggagaactcgagaactgtaaatatataactgctgaatccgaattcgat
gctgcatcaatcttggttggcgcctctgcaactggtgcgaggactttcactgcgacatgc
tcacagggtttgatattgatgagtgaagttctgtttaacgcagccgggatgaggctacca
atagtaatggttaacacgaacagagctatatctgcaccgcttagcatatggaacgatctc
caagacagcatggtgttgagagatgccggtataattcagatatacgttgaggataatcag
gaagctcacgagatgattccccaagcttacaagattgctgaaagcgtaatgtttccaacg
atggtttgtatggatggtttcaagctaactcacgcttatgagccaatagatttgctcgat
caggagttggtagatagcttccttccaccctacgatcctccgataaagctctcagtagat
aatcctctaacgtttggctcctacgctccaccgcactgctacatggagttcagatacaga
atgcacaaagacatggtcaacgctaaaaagacaatcgagaaagtcttcaaagaatgggct
gaaataaggagagactggggaggattgatagagtacaaggaggggaagactgttcttgtc
gcaatgggttccttgataggaactataaaagaggtagctgaggagaacggattgggttat
ctcaagataagaacttacagaccattcccaaccgaagaaataaaagaggctttgaaagat
tgtgaaaacgtcatagtgtttgatagagcagtttcgttcggatatgaaggaattttaacc
atagatatcagaaacgcactctacggcgaatcaccagatgtctactccttcatagtaggt
ttaggtggtagagatgttccaaagaaactcatagaaaagtgtgtttcgaaggtagttaac
aaagagattaagcccagttacagttttgaaggtttaaaggagtttgaggaggtgctatac
tga

DBGET integrated database retrieval system