KEGG   Acetobacter pomorum: CPF11_01650Help
Entry
CPF11_01650       CDS       T05180                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
apom  Acetobacter pomorum
Pathway
apom00020  Citrate cycle (TCA cycle)
apom00620  Pyruvate metabolism
apom01100  Metabolic pathways
apom01110  Biosynthesis of secondary metabolites
apom01120  Microbial metabolism in diverse environments
apom01130  Biosynthesis of antibiotics
apom01200  Carbon metabolism
Module
apom_M00009  Citrate cycle (TCA cycle, Krebs cycle)
apom_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:apom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CPF11_01650
   00620 Pyruvate metabolism
    CPF11_01650
Enzymes [BR:apom01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     CPF11_01650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO
Motif
Other DBs
NCBI-ProteinID: ATI13316
Position
complement(339988..341487)
Genome map
AA seq 499 aa AA seqDB search
MSSTTTDTASSVDVVLIGGGVMSATLGTLLRQLQPDWSISIFERLDSVAEESSNAWNNAG
TGHSALCELNYTPQQADGSVDISKAINVNEQFQVSRQFWTYLVEQNILASARDFLTPVPH
MSFVWGDKNVSFLQARYKALSAHPLFSGMEFAQDQAQIAQWAPLIMRNRPAGQNLAVTRS
LRGTDVNFGALTRLLFTYLVSTPACTLHTKHDVHDIRRGSDGRWVIKVQDTRLNTEREVK
ARFVFIGGGGGALPLLQKTGIPESRGVGGFPVSGQFLRCTNPDIIAQHHAKIYGKASVGA
PPMSVPHLDTRMIDGTPALLFGPYAGFSTRFLKNGSLMDLPRSIRAGNISAMLAVARDNW
PLTKYLIEQVMQSHNDRIKALRDFIPDAQAKDWELVVAGQRVQIIKKDAKKGGVLQFGTE
VISSADGSVAALLGASPGASTAAPIMLTVLKKCFASKLPEWEDKLKQIIPSYGQKLADNT
ALCAQLFDKTTSVLGLKEA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagttccaccacgaccgataccgcttcttctgttgatgtcgtcctgatcggtgggggc
gtcatgagcgccacgctgggaaccctgctgcggcagcttcagccggactggagcatcagt
atttttgaacgcctggatagcgtggcggaagaaagctccaacgcctggaataatgccggc
acaggccattccgctttgtgtgagttgaattacacaccacagcaggccgatggcagcgtt
gatattagcaaagccattaacgtaaacgagcagtttcaggtttctcgccagttctggaca
tatctggttgagcagaacattctggcttctgcgcgagatttcctaacccccgtgccgcat
atgagctttgtatggggggataaaaacgtgtccttcctgcaagcgcgttacaaggcgctg
agtgcgcatccgctgttttccggcatggagtttgcgcaggatcaggcgcagattgcgcag
tgggcaccactcattatgcgtaatcggcccgcagggcagaatttggccgttacccgcagc
ctgcgtggcacggatgtaaactttggtgcattaacgcgcttactgtttacctatctggtg
agcaccccggcttgcacactgcatacaaagcatgatgtgcatgatattcgccggggttca
gatggccgctgggttatcaaggtgcaagacacgcgcctgaataccgagcgtgaggttaag
gcgcggtttgtctttattggcgggggtggcggagccctgccgctgttgcagaaaacgggt
attccagaatctcgcggtgttggcggttttccggtgagtggccagttcctgcgctgtacc
aacccggatattattgcccagcatcatgccaaaatttacggcaaggcttctgttggcgcg
ccgcccatgtctgttccgcatttggatacacgcatgatagatggcacaccagcactgctg
tttggcccatatgcgggcttttccactcggttcctgaaaaatggttctctgatggatctg
ccgcgttccatccgggcgggcaatatcagcgccatgctggcggtcgctcgtgataactgg
ccgctcaccaagtatctgatcgaacaggtcatgcagtctcacaatgatcggataaaggcg
ctgcgtgactttattcccgatgcccaagccaaggattgggaactggttgtagcgggccag
cgtgtgcagattatcaagaaagacgccaaaaaaggtggtgttctgcaatttggtacggaa
gttatttccagcgcagatggatctgtggccgcacttctgggggcttctccgggagcatct
accgcagccccaattatgctgacagtgctgaagaagtgctttgccagtaagctgccagaa
tgggaagataagctgaagcagattatcccatcttacggccagaaactggcggataatacg
gcactgtgtgcacagctatttgataaaaccaccagcgttctggggctgaaggaagcctga

DBGET integrated database retrieval system