KEGG   Acetobacter pomorum: CPF11_03905Help
Entry
CPF11_03905       CDS       T05180                                 

Definition
(GenBank) hypothetical protein
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
apom  Acetobacter pomorum
Brite
KEGG Orthology (KO) [BR:apom00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:apom03009]
    CPF11_03905
Enzymes [BR:apom01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     CPF11_03905
Ribosome biogenesis [BR:apom03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CPF11_03905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsJ Methyltr_RsmB-F
Motif
Other DBs
NCBI-ProteinID: ATI11684
Position
819585..820559
Genome map
AA seq 324 aa AA seqDB search
MSTIRTAWLAADGLTSVLEADLAWRGVTIDRWHGRLALSSSKPVYSPWALDIWLNPQVVE
ITSIRNAADTLRALQRNWSLYAVDHFRRTALITDKLPPVKAAPLVFPTLPPTSPLGAWTL
LDTNTLLFSARKTSPFVNGAPQFVENRTGPPSRAYLKLWEACTRLGRWPTPNERCYDLGA
TPGGWTWAIANLGAQVTAFDRAPLDPKVAAMPGVSFQQASAFGLEPEKLAAVDWMFSDII
AYPQRLLRLTQNWMTSGNTNNIVLTVKFQGETDHEIVAAFEAIPGGSLAHLAHNKHELTF
FWNKAAAAENRPTLAGTNLAEEAA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccattcgcacagcatggcttgccgccgatggcctgacatccgttttagaagct
gatctggcatggcgcggcgtgacaattgaccgctggcatggccgtttagcactttccagc
agcaaacccgtatattccccttgggcgctggatatctggctgaacccacaggtggtagag
ataacctctatccgcaatgccgcagatactttgcgtgctcttcagcgaaactggagcctg
tatgcggttgatcactttcgacgcaccgcgctgattacagacaaactgcctccggttaaa
gcggcgccactggtgtttcccacactgccgcccaccagccccttgggtgcgtggacgctg
ctggataccaacacgctgcttttttctgcgcgcaaaaccagcccgtttgtaaatggtgca
ccgcagtttgtagaaaaccgcaccggcccaccttctcgcgcctatctgaaattatgggaa
gcctgcacgcgccttggccgctggcccacaccgaatgagcgttgttatgatctgggtgcg
acaccgggcggatggacatgggccattgccaaccttggggcacaggtaacagcgtttgac
cgcgcaccgcttgaccccaaagtggccgccatgccgggcgtatccttccagcaggccagc
gcctttgggttggaacccgaaaaacttgctgcggtggactggatgttttcagacatcatt
gcttacccgcagcgccttttacggcttacgcaaaactggatgacttctggcaacaccaac
aacattgtgctgacggtgaagtttcagggtgaaaccgaccatgaaattgttgctgcgttt
gaggccattccgggtggcagcttggcgcatctggcccataacaaacatgagctgacattt
ttctggaacaaagcagccgcagccgaaaacaggcccacattagcaggcacaaaccttgcg
gaagaagccgcgtaa

DBGET integrated database retrieval system