KEGG   Acetobacter pomorum: CPF11_04505Help
Entry
CPF11_04505       CDS       T05180                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
apom  Acetobacter pomorum
Brite
KEGG Orthology (KO) [BR:apom00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CPF11_04505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ATI11786
UniProt: A0A346DW89
Position
944424..946037
Genome map
AA seq 537 aa AA seqDB search
MSGTLLSPAAAPRPNMKGGTNQAFRMFFMGVVTAALVFVGYSVLADLRSAGENGMAIGAF
ALLALALLIALGFEFVNGFHDTANAVATVIYTNSLPPLVAVVWSGMWNLAGVLVSSGAVA
YSVVTLLPVELILQVGSGAGHAMIFALLLSAIIWNLATWAFGIPNSSSHALVGSILGVGF
ANQLMSPAGSALYGVDWSQVRKVFSALLFSPVCGFVLAAGMLILMRLVIRNAALYRAPEG
DAPPPLWIRGLLVGTCTGVSFFHGSNDGQKGMGLIMLILIGAAPTAYALNRAMPDDMMPA
FVQTAQQAAHVFEVHGSPAPSLPSAEEARAQVTDALRTKAIARPEIYSALGVLSDDIAQS
VGSYHSLQAIPAAAVPNVRTDMYLVAEAVRNMGKVSGFTGDETAELSKFMGQLNAGTRFI
PTWVKIAVALALGLGTMVGWKRIVVTVGEKIGKTHLTYAQGAAAELVAMGTIGLAERYGL
PVSTTHILSSGVAGTMVAGGGGLQWATLRAMAMAWVTTLPAAMLISGVLYFIFRHIF
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcacgttgctgagtccggctgccgcaccacgcccaaacatgaagggaggcacc
aaccaggccttccgcatgttctttatgggtgtggtgacggctgctcttgtttttgtaggg
tatagtgttctggcagacctgcggtctgctggtgaaaacggcatggccattggggccttt
gctttattggccttggcgctgctgattgcgctggggtttgaatttgtaaacggctttcac
gatacggcaaacgccgtggccaccgtcatctacaccaacagcctgcccccattggtggcg
gttgtgtggtctggcatgtggaaccttgcgggcgttctggtttcatccggggcggtggcg
tacagcgttgttacgcttctgccagtagagcttatcttgcaagttggcagcggcgctggc
catgccatgatttttgccctgctgctttccgccattatctggaacctggccacatgggcc
tttggtattcccaacagctcctcccacgctttggtggggtctatccttggtgttggcttt
gcaaaccagcttatgtctcctgctggtagcgccctgtatggggtggactggtctcaggtg
cgcaaggttttttctgccctgctgttttcccccgtttgcggctttgtgctggctgcgggc
atgttaatcctgatgcgtctggttatccgcaacgcagccctgtatcgcgccccagagggt
gatgccccgccgccactgtggatccgtggcttgctggtaggcacctgcacgggtgtttcc
ttctttcacggcagtaacgatgggcagaagggcatgggccttatcatgcttattcttatt
ggtgcggcccctacggcgtatgcgcttaaccgcgccatgcccgatgacatgatgcccgcc
tttgtgcaaaccgcacagcaggccgcgcatgtgtttgaagtgcatggctcccccgcccct
agcctgccaagtgcagaagaagcccgcgcacaggttaccgatgcgctgcgcaccaaagca
atcgcccgcccggaaatctattccgcccttggcgtgctgtctgatgacattgcgcaatct
gttggcagctatcactccctccaggctattccggcagcagccgtgccaaacgtgcgcaca
gatatgtatctggtggcggaagccgtgcgcaacatgggcaaggtttctggctttacgggg
gatgaaaccgcagagctaagcaagtttatggggcagcttaacgctggcacacgctttatt
cccacatgggttaaaattgccgtggcgctggctctgggccttggcaccatggtgggctgg
aagcgcattgttgtgaccgttggtgaaaaaattggcaaaactcacctcacctacgcgcag
ggtgctgcggcagaactggtggccatgggcaccattggcctggcagaacgctatggcctg
ccggtttccaccacgcatattctttccagcggcgtggctggcaccatggttgccgggggc
ggcggcctgcaatgggccacactgcgcgccatggccatggcatgggtaacaaccctgccc
gccgccatgctgattagcggcgtgctttacttcatcttccgccacatcttctaa

DBGET integrated database retrieval system