KEGG   Acetobacter pomorum: CPF11_10790Help
Entry
CPF11_10790       CDS       T05180                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
apom  Acetobacter pomorum
Pathway
apom00030  Pentose phosphate pathway
apom00480  Glutathione metabolism
apom01100  Metabolic pathways
apom01110  Biosynthesis of secondary metabolites
apom01120  Microbial metabolism in diverse environments
apom01200  Carbon metabolism
Module
apom_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:apom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CPF11_10790 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CPF11_10790 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:apom04147]
    CPF11_10790 (zwf)
Enzymes [BR:apom01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     CPF11_10790 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     CPF11_10790 (zwf)
Exosome [BR:apom04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CPF11_10790 (zwf)
  Exosomal proteins of colorectal cancer cells
   CPF11_10790 (zwf)
  Exosomal proteins of bladder cancer cells
   CPF11_10790 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ATI12883
Position
complement(2289573..2291207)
Genome map
AA seq 544 aa AA seqDB search
MYVVNDAAHQNPLQTHGRPSISTAPCSCSGHFARKPRLFYGGHPPPADQREPCIMALVNR
TEPFDFVIFGATGDLTRRKLLPAFLRRFHAREFDEEARIICTARSELTTEQFRNLCSATL
HEFAPDIAKDTETLNQFLGLLTYVYLDATQDASHWPELSATLPNPERTRVFYFATAPALY
SAICAGLSHHNLITQHTRVVLEKPIGTDLQSANEINEGVGRYFSEDAIYRIDHYLGKEGV
QNILALRFANPALEQLWSSQAIAHVQITAAETVGVGDRGSYYDKSGALRDMVQNHLLQVL
CMVAMDAPASLRADDLRNEKLKVLNALRPMTPDMVRKNVIRGQYTAGRVKGEDVPGYVDD
LKTGRPSDTETFVAIRTKVRTARWGDTPFYLRTGKRLATKTTEIVIQFRPQVWPIFTNMP
SPGRLVIRIAPHEELSLVLAARDPGAGGFRVRNATLHMSYENEFSVQYQDSYERLLLDAV
RGDPALFIRRDEVEASWKWVEPILDSWRYALTPLEPYPAGSWGPPTTRALLARDGALWHE
DMLT
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
gtgtatgtggtcaatgatgcagcacatcagaaccccttgcaaacacacgggcggccttcc
ataagcacagcaccttgttcttgttctgggcattttgcccgcaaaccacgacttttttac
ggcgggcacccccctccggctgaccagcgagaaccctgcatcatggctcttgtgaaccgc
acggaaccttttgactttgttatctttggcgcgacaggtgatctgacacgccgaaaactg
ctgcctgcatttttgcgccgcttccatgcccgcgaatttgatgaggaagcacggattatc
tgcacggcgaggtctgaactcaccactgagcagttccgtaatttgtgcagcgccactttg
cacgaatttgcccccgatattgccaaagacacagaaacactgaaccagtttctggggctt
ttgacctatgtgtaccttgatgccacgcaggatgcctctcactggccggaactcagcgcc
acgctccctaacccagaacgcacgcgggttttctattttgccacggcaccggcgctgtat
tccgccatttgcgctgggctttcccaccataacctgatcactcagcacacacgggttgtg
ctggaaaaacccattggcacagacctacaatctgccaatgagatcaatgaaggtgtgggc
cgctacttttctgaagatgccatttatcggattgaccattatctgggtaaagaaggcgtg
cagaatattctggccctacgctttgccaaccctgctctggaacagttatggtcttcccag
gcgatcgcccatgtgcagattaccgcagcagaaacagtgggcgtgggagaccgcggctcc
tactacgataaatccggcgcattacgagatatggtgcagaaccaccttttgcaggttctg
tgcatggttgccatggatgccccagcctctctgcgcgcagatgatctgcggaatgaaaag
ctgaaagtgcttaacgccctgcgccccatgacaccggatatggtgcgtaaaaatgttatc
cgtgggcaatacacagcgggccgcgtaaaaggggaagatgttccgggctacgtggatgat
ctgaaaacgggccgccctagtgataccgaaacatttgtagccattcgcaccaaagttcgt
acggcccgctggggtgatacgcctttttacctgcgcacaggcaaacggttggctacaaaa
accacagaaattgtaatccagttccgcccgcaggtttggcctatttttaccaacatgccc
tctcccggccggttggttatccgcattgccccgcatgaagaactctcacttgttctggca
gcgcgagaccccggagcaggtgggtttagagtgcgcaacgccacactgcatatgtcttac
gaaaacgaattttctgtgcagtatcaggattcctacgagcgcttactgctagacgctgta
agaggagaccctgccctttttatccggcgcgatgaagttgaggcctcgtggaaatgggta
gagcctattctggactcctggcgctacgctcttacgccgctggaaccctaccccgccgga
agctggggccctccaaccacgcgtgcacttctagcgcgtgatggcgccctttggcacgaa
gatatgctgacatga

DBGET integrated database retrieval system