KEGG   Acetobacter pomorum: CPF11_11220Help
Entry
CPF11_11220       CDS       T05180                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
apom  Acetobacter pomorum
Pathway
apom00051  Fructose and mannose metabolism
apom00520  Amino sugar and nucleotide sugar metabolism
apom01100  Metabolic pathways
apom01110  Biosynthesis of secondary metabolites
apom01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:apom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CPF11_11220
   00520 Amino sugar and nucleotide sugar metabolism
    CPF11_11220
Enzymes [BR:apom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     CPF11_11220
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     CPF11_11220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase NTP_transf_3 Cupin_2 AraC_binding
Motif
Other DBs
NCBI-ProteinID: ATI12950
Position
2376285..2377784
Genome map
AA seq 499 aa AA seqDB search
MDEYFKNLMDLCMSAKKETATSVHVANGQEVVPVILSGGSGSRLWPVSRGSYPKQFWPLL
TEKTLLQETALRGVAAKLCGPVVICNAEHRFIIAEQLRDVGVQDARIVLEPVGRNSAPAI
AAAAFLAAEKDPNAVLWVMAADAAITDTQCLYKALESAVQAAQAGYVVTFGMKPSRPETG
YGYIEEGAPLSGLSGVCRVARFVEKPDAQTAHHFLESGKYLWNSGMFVARACTFLHELQK
YEPELYECVRQAVEKRQTDMDFERLDVESFKKSPDISVDYAVAERTDKAAVVPADFGWSD
IGSWDSLWELSTKDKNANAVYGNVMLEDVHDSYIRTDGTLTVALGVENLTIVVTQDAVMV
ARKDRAQDVKNIVERLKSEGRTEATHHARTYRPWGFYEGLTQGDRFQVKRIVVNPAQKLS
LQKHFHRSEHWVVVEGTALVTRGDEELLVRENESVYLPLGMLHRLENPGRIPLTLIEVQS
GPYLGEDDIVRVQDLYSRE
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
ttggacgaatatttcaaaaatctgatggatttatgcatgtccgctaagaaagaaacagcc
acttctgtgcatgtagccaatgggcaggaggttgtgcctgttattctttctggtggttca
ggcagccgtctgtggccagtttctcgcggaagttatcccaaacagttttggccattgctg
acagaaaaaaccttgttacaggaaacagctctgcgtggcgtagccgccaaattgtgcggg
ccggttgtgatctgcaatgccgagcaccgttttattatagcagaacaactgcgggatgtg
ggcgtgcaggatgcccgtattgtgctagaacctgttggccgtaattctgccccagccatt
gccgcggctgcttttttggcagcggaaaaagacccgaatgccgtgttgtgggttatggcg
gcagatgccgctataacggatacgcagtgtttgtataaggcgctggaaagtgctgttcag
gccgcccaagccggatatgtcgtcacgtttggcatgaagccctcccgcccggaaacaggg
tatggatatatagaggaaggagcgcctctttccggtctttctggcgtgtgccgtgtagct
cggtttgttgaaaagccggatgcgcaaacagcgcaccattttttagagagtggcaagtat
ttgtggaattcgggcatgtttgttgcccgtgcgtgcacgtttttgcatgagcttcaaaaa
tacgaacccgaattatacgaatgcgtgcgccaagctgtagaaaaacgccagacagatatg
gattttgaacgtctggacgtggaaagttttaaaaaatctcctgatatttcagtggattat
gcagttgcggaacgcacggataaagcggctgtggtgcccgccgattttgggtggtccgat
atcggaagctgggattccctgtgggaactcagcacgaaggacaaaaacgccaacgcggtt
tatggcaatgtgatgctggaggatgtgcatgattcctacatccgtacagatggcacccta
accgttgcgcttggagttgaaaatctgaccattgtggtaacgcaggatgccgttatggtt
gcccggaaggatcgggcgcaggatgttaaaaacattgttgagcgtctgaaatcagaaggc
cgcacagaggcaacccaccatgcgcgcacatataggccgtggggattttatgagggtctc
acccaaggggatcgttttcaggttaagcgtattgtggtgaacccggcgcagaaactttcc
ttgcaaaagcatttccatcgctcggagcactgggtggtggtggaaggcacagctcttgta
actcgaggagatgaggaacttctcgtacgggaaaatgaaagtgtttacttgccgctgggt
atgctgcaccgccttgaaaaccccggccgtatcccccttacgctgatagaagtgcagtct
ggcccctatctgggggaggacgatattgtgcgtgtgcaggatttgtatagccgggagtag

DBGET integrated database retrieval system