KEGG   Actinobacillus porcitonsillarum: DDU33_01985Help
Entry
DDU33_01985       CDS       T05443                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
apor  Actinobacillus porcitonsillarum
Pathway
apor00471  D-Glutamine and D-glutamate metabolism
apor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apor00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    DDU33_01985
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:apor01011]
    DDU33_01985
Enzymes [BR:apor01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     DDU33_01985
Peptidoglycan biosynthesis and degradation proteins [BR:apor01011]
 Precursor biosynthesis
  Racemase
   DDU33_01985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race ETF
Motif
Other DBs
NCBI-ProteinID: AWI50339
UniProt: A0A2U8FH89
Position
complement(395560..396354)
Genome map
AA seq 264 aa AA seqDB search
MKPTILLYDSGMGGLTIYDEVRKVLPNAHYLYCFDNAFFPYSEKSEQALIERAVKIVQKI
AEKQPLDLVVVACNTASTVVLPALREHFDFPIVGTVPAIKPAAAISKTKTIGLLATVGTI
KRPYVLDLIHRYAKDCQVEKIGNTQIVELAETKLLTGTVDLPSLKECVEPWLNHPTLDTV
ILGCTHFPLLKEELKQLLPQVTYFVDSGEAIAKRVQSLLLENHHHSQEKERENTAFCTEL
TENFKNREVMMHKLGFKSLKVLEI
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgacaattcttttatatgattccggaatgggggggctcacgatttatgatgaa
gttcgcaaagtgctgccaaatgcccattatctttattgtttcgataacgcctttttcccc
tattcagaaaaatcagaacaagcgcttattgaacgagcggtcaaaattgtacaaaaaatt
gcagaaaaacaaccgcttgatcttgtggtggttgcttgtaataccgcaagcacggtggtc
ttaccggcattgagagaacattttgattttccaattgtgggaactgtaccggcaattaaa
cctgctgcggcaatttctaaaacaaaaacaatcggtttattagcaactgttggcacgatt
aaacgaccttatgttttggatctcattcaccgctatgcaaaagattgtcaggttgaaaaa
attggcaatacccaaattgttgaattagccgaaacaaaattattaacaggcacggtagat
ctaccttcattgaaagaatgtgttgaaccttggcttaatcatccgacattagatacggtt
attttaggctgtacacatttcccattattgaaggaagagctaaaacagttattgcctcag
gtaacttattttgttgattcaggcgaagcgattgcaaagcgtgttcaaagtttattgctg
gaaaatcatcatcactcgcaagagaaagaaagggaaaataccgctttttgcactgaattg
acagaaaacttcaaaaatcgagaagtgatgatgcacaaattaggctttaaaagcttaaaa
gtacttgaaatatag

DBGET integrated database retrieval system