KEGG   Actinobacillus porcitonsillarum: DDU33_02290Help
Entry
DDU33_02290       CDS       T05443                                 

Definition
(GenBank) long-chain fatty acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
apor  Actinobacillus porcitonsillarum
Pathway
apor00061  Fatty acid biosynthesis
apor00071  Fatty acid degradation
apor01100  Metabolic pathways
apor01212  Fatty acid metabolism
apor02024  Quorum sensing
Module
apor_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:apor00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DDU33_02290
   00071 Fatty acid degradation
    DDU33_02290
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DDU33_02290
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:apor01004]
    DDU33_02290
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:apor04147]
    DDU33_02290
Enzymes [BR:apor01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     DDU33_02290
Lipid biosynthesis proteins [BR:apor01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   DDU33_02290
Exosome [BR:apor04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   DDU33_02290
  Exosomal proteins of breast cancer cells
   DDU33_02290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: AWI50394
UniProt: A0A2U8FJ86
Position
complement(452700..454466)
Genome map
AA seq 588 aa AA seqDB search
MKSDLHLISRFREQAKKLAHTTALRHKENGKWVDISWQSFQSQVDKLSQALLAYGVNVQD
RVAIFAQNMPNWTITDLAVLQIRAITVPIYATNNANQTAYVLNHSEAKIIFVGDQEQLDV
VLSIAENCPHLEKIVLMKPNLSADNPRVISWDDLQAVKNTDFSAILAERLAERSLSDLFT
ILYTSGTTGEPKGVMLDFANIAHQLTAHDLALPHIDEKDSTLSFLPFSHIFERAWVAYML
HRGATICYLENTNEVRQALIELKPSLMCAVPRLYEKMYTAIWDKVNQAPLHRRALFHWAI
RTAQKGRKGLAFKLADKLVLSKLRALLGGNIRMMPCGGAKLEPAIGAFFQAIGINIKLGY
GMTETTATVSCWEADGFNVKSIGKLMPNAEVRIGENNEILVRGGMVMRGYYKKPEETASA
FTEDGFLKTGDAGEFDVEGNLYITDRIKELMKTSNGKYIAPQYIEGTLGKDKFIEQIAVI
ADAKKYVSALIVPCFDSLEAYAKQLNIKYQDRLELIKHSEILQMFEKRIENLQKELAHFE
QVKKFTLLPQAFSTKFEEITPTLKLRRKVIMERYHHYIEAMYQGSEKK
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctgatcttcatcttatctctcgctttcgcgagcaagcaaaaaaattagcccat
actacggcattacgccataaagaaaatggcaaatgggtagatatttcttggcaatccttc
caaagtcaagttgataaactttctcaagcattgttagcttatggcgtgaatgtgcaagat
cgtgtggcgatatttgctcaaaatatgccaaattggaccattacagatctagctgtatta
caaattcgtgcgattaccgtgccgatttatgcaacgaacaacgcaaatcaaaccgcttat
gttctaaatcactccgaagcaaaaatcatctttgttggcgatcaagaacagttagacgta
gtgttaagcattgcagaaaattgtccgcatttagagaaaattgtgctaatgaagcccaat
ttatccgcagataacccacgagtaatttcttgggacgatttacaagcggttaaaaatacg
gatttttctgctattttggcggaacgtttggcagagcgttcattatcagatttattcaca
attctttatacttcaggcaccaccggcgaaccgaaaggcgttatgctggattttgccaat
attgcccatcagctgactgcacacgatttggctttacctcatattgatgaaaaagacagc
actctttcatttttaccgttctcgcatatttttgagcgtgcgtgggttgcctacatgtta
catcgcggtgcaacgatatgttatttagaaaataccaatgaagtgcgccaagcactcata
gaactaaaaccgagcttaatgtgtgccgtgcctcgtttatacgaaaaaatgtacaccgct
atttgggataaagtaaaccaagcaccacttcatcgtagagcactgtttcattgggcaatt
cgtacggcacaaaaaggtcgaaaaggcctcgctttcaaattagccgataaactggtgcta
agcaaattgcgagcattgttgggcggtaatatccgaatgatgccttgtggtggcgcaaaa
ttagaacccgccattggtgcatttttccaagcgattggcattaacatcaagctaggttat
ggtatgacagaaactaccgcaaccgtatcgtgctgggaggcggacggctttaatgttaaa
tccatcggtaaattgatgccaaatgcggaagtgcgtattggcgagaataatgaaattctc
gtgcgtggcggcatggttatgcgtggttattacaaaaagccagaggaaacggcttccgca
tttaccgaagatggctttttgaaaacaggcgatgctggtgagtttgatgtagagggaaat
ctttatattacggatcgcataaaagagttgatgaaaacctctaacggcaaatatattgct
ccgcaatatattgaaggcacgctggggaaagataaatttatcgagcaaatcgccgtgatt
gccgatgcgaaaaaatatgtctctgcgttgatcgtcccgtgttttgatagccttgaagcc
tacgcgaaacagctgaatatcaaataccaagatcgtttggagctgattaaacactcagaa
attctgcagatgtttgaaaagcgtattgaaaatttacagaaagaactggcacattttgag
caagtgaagaaatttaccctcttgccacaggcattcagcacgaagtttgaggaaattacc
ccaaccctgaaactccgccgtaaagtgattatggaacgctatcatcactatattgaagcg
atgtatcaggggagtgagaagaaataa

DBGET integrated database retrieval system