KEGG   Actinobacillus porcitonsillarum: DDU33_03350Help
Entry
DDU33_03350       CDS       T05443                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
apor  Actinobacillus porcitonsillarum
Pathway
apor00620  Pyruvate metabolism
apor00630  Glyoxylate and dicarboxylate metabolism
apor01100  Metabolic pathways
apor01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:apor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DDU33_03350
   00630 Glyoxylate and dicarboxylate metabolism
    DDU33_03350
Enzymes [BR:apor01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     DDU33_03350
    1.2.1.22  lactaldehyde dehydrogenase
     DDU33_03350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA DUF1487 Phage_ABA_S
Motif
Other DBs
NCBI-ProteinID: AWI50585
UniProt: A0A2U8FI12
Position
complement(654144..655586)
Genome map
AA seq 480 aa AA seqDB search
MKTLPMYINGEFVISNSGKTFEVLNPATEEVIGVITKGTVADAQAAIDAAEAAQDAWAAL
PAIQRAGYLRKIAGGIRGRAEEIAKVISSEMGKILPLARVEVNFTADYIDYMAEWARRYE
GEIIQSDRPNEHIFLYKKPIGVTTGILPWNFPFFLIARKMAPALVTGNTIVLKPSVDSPI
NAVLFSEVVDSVGLPKGVFNVVHGSGADVGNELAANPKVGLISLTGSEPAGRKVMEAASQ
NITKVNLELGGKAPAIVFADADLDLAANAIVASRVINSGQVCNCAERVYVQREVKDQFVA
KLVERMQKVRSGNPLEDETLDMGPMVNKQGLDHAQAMVQAAVQAGGRVLTGGKAVEGKGY
YFEPTVIDNVDNSMDILRSEIFAPVIPVATFDTVDEVIALANDCEYGLTSSVYTQNINKA
MKVVSRLKFGETYVNRENFEAMQGFHAGWRKSGIGGADGKHGLEEYLQTHVVYLQYDEKV
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattgccaatgtacattaacggtgaatttgtgatttcaaatagcggcaaaacc
tttgaggtgttaaatccggcgacagaagaagtcatcggtgtgattaccaaaggtacggtt
gccgatgcacaggctgcgattgatgctgcagaagcagcacaagatgcgtgggcagcatta
ccagccattcaacgtgccggctatttgcgtaaaattgccgggggtatccgaggaagagcc
gaagaaattgccaaagtcatttcgtcagaaatgggaaaaatcttaccgcttgcacgtgtt
gaagtgaatttcactgccgattatattgactatatggcggaatgggctcgccgttatgag
ggagaaattatccaaagcgaccgcccaaatgaacatattttcttatacaaaaaaccgatt
ggcgtaaccaccggtattcttccttggaacttcccattcttccttatcgctcgcaaaatg
gcaccggcgttagtaacaggtaatacaattgtcttaaaaccaagtgtggattcgccaatc
aatgccgtgttgttctccgaagtggtagatagtgtcgggttgccgaaaggggtctttaac
gtcgttcacggttcaggtgctgatgtgggtaacgaacttgccgctaaccctaaagtgggc
ttaatttctctcacaggaagtgaaccggcagggcgtaaagtaatggaagcagcaagccaa
aacatcacgaaggttaatcttgagctaggcggtaaagcgcctgccattgtctttgccgat
gctgatttagacttagccgccaacgcgattgttgcttctcgagttatcaactccgggcaa
gtgtgtaactgtgcagagcgagtttatgttcaacgtgaagtaaaagatcagtttgtggca
aaattggtagaacgtatgcaaaaagtccgttccggtaacccattagaagatgaaacgctt
gatatgggaccaatggtaaacaaacagggtttagatcatgcacaagcgatggtgcaagca
gcggttcaagccggtggacgagtgctaacaggtggtaaagcggtggaaggcaaaggctac
tattttgaaccaaccgtcattgataatgtggataacagtatggatattctccgttctgaa
atttttgctccggttatccctgttgcaacctttgataccgttgatgaagtgattgcatta
gcaaatgactgtgaatatggcttaacctcttccgtttacacacaaaatatcaataaagcg
atgaaagttgtttcacgtttaaaatttggtgaaacctatgtaaatcgtgagaactttgaa
gcaatgcaaggcttccacgccggttggcgtaaatccggtattgggggtgccgatggtaaa
catggtttagaagaatatctgcaaacgcatgtggtttatttgcaatatgatgaaaaggtg
taa

DBGET integrated database retrieval system