KEGG   Actinobacillus porcitonsillarum: DDU33_05210Help
Entry
DDU33_05210       CDS       T05443                                 

Definition
(GenBank) multifunctional transcriptional regulator/nicotinamide-nucleotide adenylyltransferase/ribosylnicotinamide kinase NadR
  KO
K06211  HTH-type transcriptional regulator, transcriptional repressor of NAD biosynthesis genes [EC:2.7.7.1 2.7.1.22]
Organism
apor  Actinobacillus porcitonsillarum
Pathway
apor00760  Nicotinate and nicotinamide metabolism
apor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apor00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    DDU33_05210
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:apor03000]
    DDU33_05210
Enzymes [BR:apor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     DDU33_05210
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     DDU33_05210
Transcription factors [BR:apor03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    DDU33_05210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_28 HTH_19 HTH_3 CTP_transf_like HTH_31 HTH_26 FAD_syn
Motif
Other DBs
NCBI-ProteinID: AWI50915
UniProt: A0A2U8FIX8
Position
complement(1038070..1039365)
Genome map
AA seq 431 aa AA seqDB search
MTTTTHFAYLQTKRKQLKMKVNDVCNQAGVTRAYFNQLVSGKIKNPSAAKLKALHQVLNI
VEDKNQRIGVIFGKFYPIHTGHINMIYEAFSKVDVLHVVVCTDTERDLQLFKESKMKRMP
TNEDRLRWMQQIFKYQQKHILIHHLSEDGIPSYPNGWEGWANRVKELFVEKNIQPTIVFS
SEVQDKEPYEKYLNLEVHLVDPDRQHFNVSATKIRNNPFQYWRFIPKEVRPFFVKTIAIL
GGESSGKSVLVSKLANVFNTTSAWEYGREFVFEQLGGDEQAMQYSDYPQMALGHKRYVDY
AMKHAHKVAFIDTDYITTQAFCIQYEGKSHPFLDSMIKEYPFDVTILLANNTKWVDDGLR
SLGSLKQRQRFQALLKKLLEKHNIPYIEIESPSYLDRYNQTKEVVEAILNDEPIPLQFKQ
YNTDTESEGNT
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgacaactcatttcgcttaccttcaaaccaagcgtaaacagctcaaaatgaaa
gttaatgacgtgtgcaatcaagctggcgtgactcgagcttattttaatcaattagtcagt
ggcaaaattaaaaacccaagtgcagcaaaattaaaagcacttcatcaagttttaaacatt
gtagaagataaaaatcaacgtattggcgtgatttttggcaagttctatcctattcataca
ggacatatcaatatgatctatgaagcattcagtaaagtggatgttttacatgtggtcgtc
tgtacggatacagaacgcgatctccaactctttaaagagagcaaaatgaagagaatgcca
accaatgaagatcgcctacgttggatgcaacaaatttttaaatatcaacaaaaacatatc
ttaattcatcatttatctgaagacggaattccaagctatcctaacggttgggaaggttgg
gcgaatcgagtaaaagaattatttgttgaaaagaatattcaaccgaccatcgtgtttagc
agcgaagtgcaagataaagaaccttatgaaaaatacctcaatttagaggttcatttagtc
gatcctgatcgccaacactttaatgtttcggcaaccaaaatccgcaataatccgttccaa
tactggcgttttattccaaaagaagttcgtccatttttcgtgaaaacgattgcgatttta
gggggagaaagtagcggtaaatccgttcttgtgagcaagctggcaaatgtctttaataca
acgtctgcttgggaatatggtcgtgaattcgtattcgagcaactcgggggcgatgaacaa
gcaatgcaatactccgattatcctcaaatggcactcggacacaaacgctacgtagattat
gcgatgaagcatgcccataaggtggcatttattgatacagactacatcacaacacaagcc
ttttgtattcagtatgaaggaaaatcgcatccgtttttggactcgatgattaaggaatat
ccttttgatgtaaccattttactggctaataatactaagtgggttgatgacggtttgcgt
agcttaggctctttaaaacaacgccaacgtttccaagcattactcaaaaaattgttagag
aaacataatattccttatattgaaattgaatcgccaagctatttagatcgctataatcaa
acaaaagaagtggttgaagctattttgaatgatgagccaattccgttacaatttaagcaa
tataatacagataccgaatcggaaggtaacacatga

DBGET integrated database retrieval system