KEGG   Actinobacillus porcitonsillarum: DDU33_09635Help
Entry
DDU33_09635       CDS       T05443                                 

Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
apor  Actinobacillus porcitonsillarum
Pathway
apor00270  Cysteine and methionine metabolism
apor00920  Sulfur metabolism
apor01100  Metabolic pathways
apor01110  Biosynthesis of secondary metabolites
apor01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:apor00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    DDU33_09635
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    DDU33_09635
Enzymes [BR:apor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     DDU33_09635
    2.3.1.46  homoserine O-succinyltransferase
     DDU33_09635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Peptidase_S28 Hydrolase_4
Motif
Other DBs
NCBI-ProteinID: AWI51728
UniProt: A0A2U8FL85
Position
1995613..1996683
Genome map
AA seq 356 aa AA seqDB search
MALSLTLFEEAPLSLTFGGTLSPIQVAYQTYGTLNENKSNAVLLCHALTGDAEPYLPPPN
KGWWQDFIGPGLAFDTDQYFFICSNVLGGCKGTTGPSSINPQTGKPYGSQFPVITVQDIV
NVQKALLDKLNIPHLHAVVGGSFGGMQATQWGISYPHFVDNIINLCSSLTLSAEAIGFNH
VMRQAIINDPCFNQGDYYEGIAPDNGLKIARMLGMLTYRTDIQLAKAFGRETKQHGQMWG
DHFQVESYLTYQGEKFLDRFDANSYLRLLRALDLYDPAQGFENESSALTRIKANYTLVAV
TSDQLFKQIDVHKSRQRLIDAGIKVNYHEFNSTFGHDSFLVDYDFFEPMIKQALKK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggctctctctcttactctctttgaagaagctccgctttcactcacatttggcggaaca
ctttctccaattcaagtagcatatcagacttacggcacgctcaatgaaaataaaagcaat
gccgtactcctttgccacgcattaacgggggatgccgagccatatttacctccacccaac
aaaggttggtggcaagattttattggtccgggacttgcttttgataccgaccaatatttc
tttatctgttctaacgtacttggtgggtgtaaaggtacgacagggccttcatcaatcaat
cctcagaccggtaaaccttacggaagccaattccctgttattaccgttcaagatattgta
aatgtacaaaaagcattactcgataagctcaatattccacatttacatgccgttgttggc
gggtcttttggcggaatgcaggcaacccaatggggtatttcataccctcattttgtggat
aatattatcaatctttgttcatccctcacattgagtgccgaagccattggctttaaccac
gttatgcgccaagccattatcaacgatccttgtttcaaccaaggggattattacgaagga
attgcacctgacaatgggttaaaaatagccagaatgttaggcatgctaacatatcgaact
gatattcagttagcaaaagcatttggcagagaaacaaaacaacacggacaaatgtgggga
gaccatttccaagttgaatcttatttaacttatcaaggtgaaaagtttttagaccgcttt
gatgctaatagttatctacgtttactccgagctcttgatctatatgatcccgcacaagga
tttgaaaatgagtcttctgctttaacacgtattaaagcaaactacactttggtggcagtt
acaagcgatcaattatttaaacagatagatgtccataaaagccgccaacgtttaattgat
gctggtattaaagtcaattatcacgaatttaattccacttttggacatgattcctttctt
gtcgattatgatttctttgagcctatgattaaacaagcattaaaaaaatag

DBGET integrated database retrieval system