KEGG   Accumulibacter phosphatis: CAP2UW1_0066Help
Entry
CAP2UW1_0066      CDS       T00966                                 

Definition
(GenBank) transferase hexapeptide repeat containing protein
  KO
K13018  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase [EC:2.3.1.201]
Organism
app  Accumulibacter phosphatis
Pathway
app00520  Amino sugar and nucleotide sugar metabolism
app01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:app00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CAP2UW1_0066
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:app01005]
    CAP2UW1_0066
Enzymes [BR:app01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.201  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase
     CAP2UW1_0066
Lipopolysaccharide biosynthesis proteins [BR:app01005]
 Unusual sugar
  CAP2UW1_0066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2 BacteriocIIc_cy
Motif
Other DBs
NCBI-ProteinID: ACV33439
UniProt: C7RIV3
Position
76318..76893
Genome map
AA seq 191 aa AA seqDB search
MVLSIHPSAIVDEGAQIGDGSRVWHFAHICAGARIGTDCSFGQNVFVGNDVAIGNNVKVQ
NNVSIYDAVQIEDDVFCGPSMVFTNVYNPRSAVTRKDEYRPTTIKRGATLGANSTIVCGV
TVGRFAFVAAGAVVTRDVKPYALMAGVPARQIGWISKHGERLRLPLEGDGVAQCPVTGET
YKLTGTTLAVE
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctccatacacccttctgcaattgtcgatgagggcgcacaaatcggcgatggt
agccgcgtctggcattttgcccacatttgcgctggtgccaggattggcacagactgttcc
ttcggccagaacgtcttcgtcggtaacgacgtagcgatcggcaacaacgtcaaggtgcag
aacaacgtttccatctacgacgccgtgcagatcgaggacgacgtcttctgcggcccaagc
atggtgtttaccaacgtgtacaacccgcgttccgcggtcacccgcaaggatgagtatcgc
ccgacgacaataaagcggggcgcgactcttggggcgaacagtacgatcgtctgcggggta
acggttggtagattcgcctttgtcgctgcgggtgcggtggtgactcgtgacgtcaagccc
tatgctctgatggctggtgtgccggccagacagataggctggatcagcaagcatggcgag
cgtctacggctgcccctggagggagacggagtagcgcaatgcccggtgacgggtgagacc
tacaagctgacggggacgacgctggcggttgaatga

DBGET integrated database retrieval system