KEGG   Accumulibacter phosphatis: CAP2UW1_0395Help
Entry
CAP2UW1_0395      CDS       T00966                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
app  Accumulibacter phosphatis
Pathway
app00670  One carbon pool by folate
app01100  Metabolic pathways
app01120  Microbial metabolism in diverse environments
app01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:app00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CAP2UW1_0395
Enzymes [BR:app01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     CAP2UW1_0395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: ACV33748
UniProt: C7RKF7
Position
complement(467181..468020)
Genome map
AA seq 279 aa AA seqDB search
MTKDTRTFSLELFPPQTAEGAEKLRATRAQMALLKPRFFSVTFGAGGSTRDRTLETVLDI
QREGHAAAPHLSCIGSTRESIRSILEQYRAHGIRHLVALRGDLPSGMAQPGTFRYANELV
EFIRAATGDWFHIEVAAYPEYHPQARSPLDDLLAFRRKLEAGANSAITQYFYNFDAYAQF
IDQCRRIGIEVPIVPGIMPISSYSSLARFSDNCGAEIPRWIRKKLESYGDDSASIRAFGL
DVVTQLCEKLLASGAPGLHFYTLNQASLTSTLWQRLGLT
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagacactcgcaccttcagcctcgaactctttcccccgcagaccgccgaaggc
gccgagaagctgcgcgcgacgcgcgcccagatggcgctcctgaagccgaggttcttctca
gtgacctttggtgccggcggttcgacgcgggaccgcacgctcgaaaccgttctcgatatc
cagcgcgaagggcacgcggcggcgccgcatctttcgtgcatcggttcgacacgggaaagc
attcgcagcattctcgagcagtatcgcgcgcacggaatccgtcacctcgtcgcgctgcgc
ggcgacctgccttcgggcatggcccagccaggcacctttcgctacgccaacgaactggta
gagttcatccgcgcggcaacgggcgactggttccacatcgaggtggccgcctaccccgag
taccatccgcaagcgaggagcccgctggacgatcttctggcgttccggcgcaagctcgag
gccggcgcgaattcggccatcacccagtatttctacaatttcgatgcctacgcgcagttc
atcgaccagtgtcgaaggatcggcatcgaggtgccgatcgtccccggaatcatgccgatc
tcgagttacagcagtctggcacgcttctcggacaactgcggcgcagagatcccgcgctgg
atacgaaagaagctcgaaagctacggcgacgattcagcgtcgatccgcgccttcggcctc
gacgtggtgacgcaactgtgcgagaagctgcttgccagcggagcgcccggtctccacttc
tacacgctgaaccaggcgtcgctgaccagtacgctgtggcagcggctcggactgacctag

DBGET integrated database retrieval system