KEGG   Accumulibacter phosphatis: CAP2UW1_0573Help
Entry
CAP2UW1_0573      CDS       T00966                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine/D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
app  Accumulibacter phosphatis
Pathway
app00471  D-Glutamine and D-glutamate metabolism
app00550  Peptidoglycan biosynthesis
app01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:app00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CAP2UW1_0573
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CAP2UW1_0573
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:app01011]
    CAP2UW1_0573
Enzymes [BR:app01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     CAP2UW1_0573
Peptidoglycan biosynthesis and degradation proteins [BR:app01011]
 Precursor biosynthesis
  Amino acid ligase
   CAP2UW1_0573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C NAD_binding_2 YjeF_N 2-Hacid_dh_C DAO XdhC_C NAD_binding_7 CbiA
Motif
Other DBs
NCBI-ProteinID: ACV33922
UniProt: C7RLM8
Position
complement(688525..689892)
Genome map
AA seq 455 aa AA seqDB search
MELAGKLILVIGLGESGLAMARWLARQDAHVRVADSRPAPPQADALRAAVPAADLCVGPF
TAEAFAGVDLIAISPGVPVQEALVQAAVARGVPLVSEIELFAWGIGGLTPRARVIAITGS
NGKTTTTALVGALCRAAGRRTAVAGNIGPAALDALMSAIDGRSLPELWVLELSSFQLETT
HSLAADAAALLNLCEDHLDRYLDMDDYTASKARIFQGNGVMVLNRDDARSLAAGRPGRRM
VTFGLNPPPRPCDYGVVDGWIVRGDDRLVACSELQLVGSHNAANAMAALALCEAAGIDLA
SVLPALVAFKGLAHRVEWVAEIDGVAYFDDSKGTNVGATLAALQGLGRPVAIILGGDGKG
QDFAPLRPALDAHARAAALIGRDALAMAAILEGCQVPLQHCVDMAEAVRWCAAQARAGDA
VLLSPACASMDMYRNYEHRAEAFVDAVRRIEREAA
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggaacttgccggcaaactgatcctcgtcatcggcctcggcgaaagcggcctggcaatg
gcccgctggctggcgcggcaggacgcgcacgtgcgcgtcgccgacagtcgtccggcgccg
ccgcaggccgacgcgctgcgtgccgcggtacctgctgcagatctgtgcgtcggtccattc
accgcggaggctttcgccggcgttgatctgatcgcgatttcccccggcgtgccggtacag
gaagcactcgttcaggcggcggtggcccgtggcgtgccgctggtctccgagatcgagctg
ttcgcctggggaatcggcggactgacgccgcgggccagagtgattgcgatcaccggcagc
aacggcaagacgacgaccaccgccctggtcggcgccctgtgccgggcggccggccgccgg
acggcggttgccggcaacatcggcccggcggcactcgacgcgctgatgagcgccatcgat
ggaagaagcctacccgagctttgggtcctcgaactgtccagctttcagctcgaaacaacg
cattccctggctgccgacgccgccgccctgctcaatctctgcgaggaccacctcgaccgc
tatctggacatggacgactacacggccagcaaggcgcgtattttccagggcaacggcgtc
atggtcctcaaccgcgacgacgctcgcagcctggcggcaggacgccccggccgccggatg
gtgaccttcggcctcaatccgccgccccgcccgtgcgactacggagtcgtggacggctgg
atcgtgcgcggcgatgaccggctggtcgcctgcagcgaacttcaactggtcggtagtcac
aacgccgccaacgccatggccgcgctcgccttgtgcgaggcggcaggcattgatctggcc
agcgtgctgccggccctcgtggcgttcaagggtcttgcgcatcgcgtcgaatgggttgcc
gagattgacggcgttgcctacttcgacgattcgaaaggcaccaatgtcggcgccacactg
gccgcgctgcagggcctgggccggccagtggcgatcatccttggcggcgatggcaagggg
caggatttcgcgcccctgcggccggcactggacgcgcatgcgcgcgcggccgcgctgatc
gggcgcgacgcgctggcgatggccgccatcctggagggctgccaggttccactgcagcat
tgcgtcgacatggccgaagccgtacgctggtgtgctgcccaggcgcgcgcgggtgacgcc
gtgctgctctcgccagcctgcgccagcatggacatgtatcgcaactacgagcaccgcgcc
gaagcatttgtcgacgccgttcgtcgcatcgaaagggaggccgcctga

DBGET integrated database retrieval system