KEGG   Accumulibacter phosphatis: CAP2UW1_0761Help
Entry
CAP2UW1_0761      CDS       T00966                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
app  Accumulibacter phosphatis
Pathway
app00330  Arginine and proline metabolism
app00332  Carbapenem biosynthesis
app01100  Metabolic pathways
app01130  Biosynthesis of antibiotics
app01230  Biosynthesis of amino acids
Module
app_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CAP2UW1_0761
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    CAP2UW1_0761
Enzymes [BR:app01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     CAP2UW1_0761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ACV34106
UniProt: C7RMS9
Position
complement(882449..883567)
Genome map
AA seq 372 aa AA seqDB search
MAITRIATARRLVIKVGSALVTNNGEGLDLAAIDEWARQIASLRRSERQVILVSSGAIAC
GMQRLEWHKRPRAVHELQAAAAVGQMGLAQAYESAFARHALHTAQILLTHDDLADRKRYL
NARSTLTTLLELGVVPIINENDTVVTDEIKFGDNDTLGALVANLVEADCLIILTDQQGLF
TADPRKDETATLISEARAGLPALEAMAGGAGTQFGKGGMITKVIAAKRAARSGAHTVIAS
GRESDVMLRLARGESLGTLLVSETQALTARKQWLADHLQLNGKLTLDRGAVRALREGKSL
LPIGVLAVQGEFERGAAVACVTGDGKEIARGLANYGSSDSRRIARHASQDIEDILGYIDE
PEIIHRDNLILT
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggccatcacccgcatcgccactgcccgccgactggtcatcaaggtcggctccgccctg
gtcaccaacaacggcgaaggactcgatctcgccgccatcgacgagtgggccagacagatc
gccagcttgcggcgttcggagcgacaggtgatcctcgtctcctccggcgccatcgcctgc
ggcatgcagcgcctcgaatggcacaaacgcccgcgcgccgtgcacgaactgcaggcggca
gcggcagtcggccagatggggctggcccaggcctatgaaagtgcctttgcacggcacgcc
ttgcacactgcgcagatcctgctcacgcatgacgacctcgccgaccgcaagcgttacctc
aatgcacgctcgacactgactacgctcctcgaactcggtgtcgtaccgatcatcaacgag
aacgacaccgtcgtcaccgacgaaatcaagtttggcgataacgacacgctcggagcgctg
gtcgccaacctcgtcgaagccgattgtctgatcatcctcaccgatcagcaaggcctgttc
actgccgatccgcgcaaggacgaaaccgccacgctgatcagcgaagcgcgtgccgggctg
ccggcactcgaagcgatggccggcggcgccggcacgcagttcggcaaaggcggcatgatc
accaaggtcattgccgccaagcgtgcggcgcgcagcggagcgcacacggtcatcgccagc
ggccgggagagcgatgtcatgctgcgactggcgcgcggggaatcgctcggcaccctcctg
gtatcggagacgcaagccctcacggcgcgcaagcaatggctggccgaccacctccagctc
aacggcaaactgacgctggacagaggtgccgtgcgcgcgctacgggaaggcaagagcctg
ctgccgatcggcgtccttgccgtccagggagaattcgaacgtggtgcggccgtcgcttgt
gtcacgggcgatggcaaggagattgcgcgtggcctcgccaactatggcagcagcgactcg
cggcgaattgcgcgccacgccagccaggacatcgaagacatccttggctacatcgacgag
ccggaaatcattcaccgtgacaacctgatcctgacctag

DBGET integrated database retrieval system