KEGG   Accumulibacter phosphatis: CAP2UW1_1149Help
Entry
CAP2UW1_1149      CDS       T00966                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
app  Accumulibacter phosphatis
Brite
Enzymes [BR:app01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     CAP2UW1_1149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 PrmA Methyltransf_11 Methyltransf_12 RrnaAD Methyltransf_23 Methyltransf_18 MTS Ubie_methyltran GCD14 Methyltransf_24 DUF938 NodS ADH_zinc_N_2 Methyltransf_4 Methyltransf_32 ChitinaseA_N
Motif
Other DBs
NCBI-ProteinID: ACV34480
UniProt: C7RRJ1
Position
complement(1317887..1318552)
Genome map
AA seq 221 aa AA seqDB search
MSAVKMDMEQARFNMIEQQIRPWEVLDPEVLDILATVKREDFVPAAHRALAFADLELPIG
NGQTMLQPKIDARVLQEVNVRSTDIVLEVGTGSGYMAALLAANAEYVHTVEIDPVLAETA
RHNLRQAGITNVSVEVGDASQGWSASSPYDVIVISGALRELPEAFLQQLKPGGRLVAFIG
EPPVMEAQLVTRTGDRAFTTINLFETVVAPLSSRKRPRFVF
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcggtgaagatggatatggaacaggctcgcttcaacatgatcgagcaacagatc
cgcccctgggaggttctcgatcccgaggtgctcgacattctcgcgacggtcaagcgtgag
gatttcgttccggccgcgcaccgggcactggcttttgcggacctcgaactgccgatcggc
aacggtcagaccatgctccagccgaagatcgatgcccgcgttctccaggaagtgaacgta
aggagcaccgacatcgtccttgaggtcggtaccggtagtggctacatggccgccctcctg
gcggcgaatgcggagtacgtccatacggtcgagatcgatcccgtcctggcggaaaccgcc
cggcacaaccttcggcaggcgggcatcaccaatgtcagcgtcgaagtcggagacgcttcg
caaggctggtcggcgtcgtcaccctacgacgtcatcgtcatctccggcgcgctccgcgaa
ttgccggaggcgtttctccaacaactgaagcctgggggtcgactggtggcgttcatcggc
gagccgccggtgatggaggcccagctggtcacccgcacaggcgacagggcgttcaccacc
atcaaccttttcgaaaccgtggtcgcaccactgagcagcaggaagcgcccgcgcttcgtt
ttctga

DBGET integrated database retrieval system