KEGG   Accumulibacter phosphatis: CAP2UW1_1494
Entry
CAP2UW1_1494      CDS       T00966                                 

Definition
(GenBank) type I secretion membrane fusion protein, HlyD family
Organism
app  Accumulibacter phosphatis
SSDB
Motif
Pfam: HlyD_3 HlyD_D23 HlyD Biotin_lipoyl_2 Biotin_lipoyl Exonuc_VII_L
Other DBs
NCBI-ProteinID: ACV34809
UniProt: C7RT66
Position
complement(1689909..1691285)
AA seq 458 aa
MPTPFTRKPPNPDALDFSPPLLRLTDSPPNPLGRQVLWTLLALLAALLGWGLIGELDIVA
VADGKLIPQSYLKIVQPAESGIVKEILVSEGQSVAAGQVLMRMDTLISDADFNALTTDHL
RKRATLARIDAELANRPYAPPRGDAPELAREMAAQYHANRAALAAALAEEESHLLKARHD
LASAQQIRRKLADTLPHYRAQDEAFEGLARDGFAGALLASDKKRERIEKEQELKTQDHLI
ESARAAISQSERKLAQIASEYRRQLHSERNEIQGHTDRLAQELAKQSHRQTLLELKASQE
SVVKDLATHSPGTVVQPGTVLLTLVPKDDILRAEVWVSNEDIGFVRQRQPVKLKFAAFPF
QKYGMVEGTVEHIGADSADGPGSGASEAGRNDSPARSRPLVYKALVALKQPHLEIDGQRF
ALSAGMQTHAEILLGRRTVAEYLLSPVRKAWHEAARER
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgccgaccccgttcacccggaaaccgcccaaccccgacgcgctcgacttctcgccgccc
ttgctgcgcctcaccgactcgcccccgaacccgctcggtcgccaggtgttgtggaccttg
ctggccctgctggcggcgctgctgggctggggcctgatcggcgaactcgacatcgtcgcc
gtcgccgacggcaaactgatcccgcaaagctacctgaagatcgtccagccggctgaatcc
gggatcgtcaaggaaatcctggtcagtgaaggccagtccgtcgcggcggggcaggtgctg
atgcgcatggatactctgataagcgacgcggacttcaacgcactgaccaccgaccacctg
cggaagcgtgcgacgctggcgcgcatcgacgccgagctggcgaaccggccgtatgccccg
ccccgcggcgatgcccccgaactcgcccgtgaaatggccgcccagtaccatgccaatcgt
gccgctctcgcggccgcgctcgccgaagaggaaagccatctgctcaaggctcgccacgac
ctggcatcggcccagcagattcgccgcaaactggccgacacgctgccgcactaccgcgcg
caggacgaagccttcgagggactcgcccgcgacggctttgccggtgcgctgctggccagc
gacaagaagcgggaacgcatcgagaaggagcaggaactcaagacacaggatcacctgatc
gagtctgcccgggccgccatctcccagtccgagcgcaagctcgcgcagatcgccagcgag
tatcggcgccagctgcacagcgagcgcaacgaaatccaggggcacaccgacaggctggcg
caggaacttgccaagcaaagccaccgccagacgttgctcgaactgaaggccagccaggag
agcgtcgtcaaggacctggcgacgcacagcccgggcaccgtggttcagccgggcacggtc
ctgctgacgctggtgccgaaggacgacatcctgcgcgcggaagtgtgggtgtcgaacgaa
gacatcggtttcgttcgccagagacagccggtcaagctcaagttcgccgccttcccgttc
cagaagtacggcatggtcgagggaacggtcgaacacatcggcgccgactcggcggacggc
ccgggcagcggcgcatcggaagcgggcaggaatgactcgccagccaggagccggccgttg
gtctacaaggcgctggttgcgctcaagcagccgcatctggagatcgacggccagcgtttc
gcgctcagcgccggcatgcagacccatgccgagatcctcctgggtcggcgcacggtggcc
gaatatttgctctcaccggtgcgcaaggcctggcatgaggcggccagggaacgctga

DBGET integrated database retrieval system