KEGG   Accumulibacter phosphatis: CAP2UW1_1839Help
Entry
CAP2UW1_1839      CDS       T00966                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
app  Accumulibacter phosphatis
Pathway
app00010  Glycolysis / Gluconeogenesis
app00020  Citrate cycle (TCA cycle)
app00620  Pyruvate metabolism
app01100  Metabolic pathways
app01110  Biosynthesis of secondary metabolites
app01120  Microbial metabolism in diverse environments
app01130  Biosynthesis of antibiotics
app01200  Carbon metabolism
Module
app_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAP2UW1_1839
   00020 Citrate cycle (TCA cycle)
    CAP2UW1_1839
   00620 Pyruvate metabolism
    CAP2UW1_1839
Enzymes [BR:app01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CAP2UW1_1839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Methyltr_RsmB-F Biotin_lipoyl_2 CAT
Motif
Other DBs
NCBI-ProteinID: ACV35139
UniProt: C7RV60
Position
2069978..2071624
Genome map
AA seq 548 aa AA seqDB search
MSQLIEVKVPDIGDYTDVPVIDICVIVGDVVKVDDALVTLESDKATMDVPSSAAGVVKEI
RVALGEKISEGTVVVVLEASEVRAAAPAAAVSAASPATVPAAAVTAPVPAAASGGGTVEV
KVPDIGDYHDVPVIDVCVKVGDVVKVDDALVTLESDKATMDVPSSAAGVIREIRVGLGDK
VSAGAVVVVLDTAGSAAAPTAAAAAPVTAAATAAPATGGVAPPPAPAAMLAAAPVPALAP
GARMHASPSVRMLARELGVDLNKVTASGPKARILKEDVTAYVKGVLSAPAVAAAAPSLGG
GLDLLPWPKMDFAKYGAVEVKPLARIKKISAQNLARNWVMIPAVTYHEDADITDLEAFRV
AMNKENEKSAQSGGLKITMLAFLIKACAVALKKFPEFNSSLDGDNLVLKQYCHVAFAADT
PNGLVVPVIRNADQKSVSQLAVESGELARKARDGKLTPGEMSGACFTISSLGGIGGTHFS
PIVNAPEVAILGVNRSVMKPVWNGKEFAPRLILPMSLSADHRVIDGALATRFNVFVAQLL
ADMRRVLL
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaattgatcgaagtgaaagtccccgatatcggcgattacaccgatgtgccggtg
atcgacatctgtgtcatcgtcggcgacgtggtcaaggtcgacgatgccctggtgaccctc
gaatccgacaaggcgacgatggacgtgccgtcgtcggcagccggtgtggtaaaggaaatc
cgcgttgcgctgggcgagaagatctcggaaggcacggtcgtcgttgtcctcgaagcgtcc
gaggtaagggccgcggcgcctgcggcggccgtctcggccgcttctccggccactgttccg
gcggcagccgtcaccgccccggtgccggcggcggcgagcggcggcgggacggtcgaggtc
aaggtaccggatatcggtgactaccacgacgtgccggtgatcgacgtctgcgtcaaggtc
ggcgacgtcgtcaaggtggacgatgccctggtcacgctcgaatccgacaaggcgacgatg
gacgtgccctcgtcggcggccggggtgatccgcgagatcagggtcggactcggcgacaag
gtgtctgcgggcgcggtcgtcgtcgtccttgacaccgctgggagcgctgccgcccctact
gctgctgccgccgctcccgtgactgccgccgcgacggcagcaccggcgaccggcggcgtt
gcaccgccgcccgcgccagcggctatgctggccgctgcgccggtcccagcgctggcgccc
ggtgccagaatgcacgccagcccgtcggtacgtatgctggcgcgcgaactcggtgtcgat
ctgaacaaggtgactgccagcggacccaaggcccgcatcctcaaggaggatgtgacggcc
tacgtcaagggcgtcctgagcgccccggccgtggccgccgcggcaccttcgctcggcggt
gggctcgacctcctgccgtggccgaagatggacttcgccaaatacggtgcggtcgaagtc
aagccactggcgcgcatcaagaagatctccgcgcagaacctggcgcgcaactgggtgatg
atcccggcggtcacctaccacgaggacgccgacatcaccgatctcgaagccttccgcgtc
gccatgaacaaggagaacgagaagtcggcccagtctggtggtctcaagatcaccatgctt
gctttcctgatcaaggcctgtgccgtggcactgaagaagttccccgagttcaacagctcg
ctcgatggtgacaatctggtgctcaagcagtattgccacgtcgctttcgccgccgacacg
ccgaacggcctcgtcgtgccggtgatcaggaacgccgaccagaagtcggtgagccaactc
gccgtcgaaagcggcgaactggcgagaaaggcacgcgacggcaagctcacgccgggggag
atgtccggtgcctgcttcaccatttccagcctcggtggcatcggcggcacgcacttctcg
ccgatcgtcaatgcgccggaagtcgccatcctcggggtgaaccggtcggtgatgaagccg
gtctggaacggcaaggagttcgcgccgcgcctgatcctgccgatgtcgctgtcggccgac
caccgcgtcatcgacggtgcgctggcgacgcgtttcaacgtatttgttgcgcaactgctt
gccgacatgcggcgcgtgctgctctga

DBGET integrated database retrieval system